Viewing data for Anas platyrhynchos


Scientific name Anas platyrhynchos
Common name Mallard
Maximum lifespan 29.10 years (Anas platyrhynchos@AnAge)

Total mtDNA (size: 16604 bases) GC AT G C A T
Base content (bases) 8068 8536 5448 2620 3687 4849
Base content per 1 kb (bases) 486 514 328 158 222 292
Base content (%) 48.6% 51.4%
Total protein-coding genes (size: 11388 bases) GC AT G C A T
Base content (bases) 5669 5719 4016 1653 2527 3192
Base content per 1 kb (bases) 498 502 353 145 222 280
Base content (%) 49.8% 50.2%
D-loop (size: 1049 bases) GC AT G C A T
Base content (bases) 491 558 329 162 264 294
Base content per 1 kb (bases) 468 532 314 154 252 280
Base content (%) 46.8% 53.2%
Total tRNA-coding genes (size: 1546 bases) GC AT G C A T
Base content (bases) 673 873 400 273 372 501
Base content per 1 kb (bases) 435 565 259 177 241 324
Base content (%) 43.5% 56.5%
Total rRNA-coding genes (size: 2587 bases) GC AT G C A T
Base content (bases) 1214 1373 682 532 516 857
Base content per 1 kb (bases) 469 531 264 206 199 331
Base content (%) 46.9% 53.1%
12S rRNA gene (size: 985 bases) GC AT G C A T
Base content (bases) 487 498 279 208 188 310
Base content per 1 kb (bases) 494 506 283 211 191 315
Base content (%) 49.4% 50.6%
16S rRNA gene (size: 1602 bases) GC AT G C A T
Base content (bases) 727 875 403 324 328 547
Base content per 1 kb (bases) 454 546 252 202 205 341
Base content (%) 45.4% 54.6%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 336 348 256 80 153 195
Base content per 1 kb (bases) 491 509 374 117 224 285
Base content (%) 49.1% 50.9%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 77 91 65 12 31 60
Base content per 1 kb (bases) 458 542 387 71 185 357
Base content (%) 45.8% 54.2%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 783 768 507 276 373 395
Base content per 1 kb (bases) 505 495 327 178 240 255
Base content (%) 50.5% 49.5%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 335 352 223 112 153 199
Base content per 1 kb (bases) 488 512 325 163 223 290
Base content (%) 48.8% 51.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 403 381 274 129 177 204
Base content per 1 kb (bases) 514 486 349 165 226 260
Base content (%) 51.4% 48.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 560 583 400 160 277 306
Base content per 1 kb (bases) 490 510 350 140 242 268
Base content (%) 49.0% 51.0%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 492 486 338 154 237 249
Base content per 1 kb (bases) 503 497 346 157 242 255
Base content (%) 50.3% 49.7%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 523 516 385 138 216 300
Base content per 1 kb (bases) 503 497 371 133 208 289
Base content (%) 50.3% 49.7%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 182 170 125 57 83 87
Base content per 1 kb (bases) 517 483 355 162 236 247
Base content (%) 51.7% 48.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 657 721 490 167 315 406
Base content per 1 kb (bases) 477 523 356 121 229 295
Base content (%) 47.7% 52.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 153 144 103 50 69 75
Base content per 1 kb (bases) 515 485 347 168 232 253
Base content (%) 51.5% 48.5%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 908 916 655 253 389 527
Base content per 1 kb (bases) 498 502 359 139 213 289
Base content (%) 49.8% 50.2%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 265 257 198 67 58 199
Base content per 1 kb (bases) 508 492 379 128 111 381
Base content (%) 50.8% 49.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 19 6 6 12 25 12 4 5 2 1 2 2 1 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 9 4 0 0 5 3 0 0 8 9 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 12 0 0 7 4 0 1 3 1 2 1 2 0 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 1 4 0 0 1 3 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 89 70 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 66 36 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 101 89 15
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFSIMVMTWLTLALLIQPKLLTFTTTNPPSKKPSLITKPTPWAWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 2 0 4 3 1 0 1 1 0 1 0 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 0 0 0 2 2 6 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 3 0 0 0 3 0 0 0 0 0 0 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 4 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 20 21 11
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 25 9 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 20 30 3
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 43 (8.33%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 34 17 7 16 26 11 2 9 1 2 16 11 5 9 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 9 28 8 1 5 14 19 9 5 12 13 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 14 2 3 9 10 2 0 3 2 15 0 1 2 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 7 3 4 11 8 1 0 0 5 3 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 127 134 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 241 166 63
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 21 (9.21%)
Threonine (Thr, T)
n = 12 (5.26%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.89%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 8 (3.51%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 9 (3.95%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 6 1 11 13 3 2 5 2 5 3 9 1 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 3 10 3 0 0 3 3 3 2 4 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 1 1 6 10 1 0 3 0 9 0 0 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 13 1 1 12 3 1 0 2 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 63 50 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 62 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 100 87 25
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 14 6 0 12 16 1 2 6 0 2 8 3 2 4 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 2 16 5 1 0 9 9 1 1 5 4 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 1 2 4 7 0 0 5 1 8 1 1 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 6 2 0 5 4 0 0 0 4 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 70 58 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 135 92 18
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 30 (7.89%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 5 (1.32%)
Valine (Val, V)
n = 19 (5.0%)
Leucine (Leu, L)
n = 64 (16.84%)
Isoleucine (Ile, I)
n = 28 (7.37%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 31 (8.16%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 24 5 8 16 27 10 3 7 1 0 8 8 3 4 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 4 3 19 8 0 2 7 12 2 3 10 11 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 9 0 3 8 11 1 0 2 3 10 0 0 3 18 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 1 6 9 1 0 2 4 2 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 113 95 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 103 78 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 184 133 39
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 27 (8.31%)
Threonine (Thr, T)
n = 20 (6.15%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 17 (5.23%)
Leucine (Leu, L)
n = 61 (18.77%)
Isoleucine (Ile, I)
n = 25 (7.69%)
Methionine (Met, M)
n = 15 (4.62%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 10 (3.08%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 19 9 4 19 27 8 2 5 1 2 6 6 3 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 1 20 10 0 0 6 3 5 6 13 4 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 2 1 9 10 1 0 6 5 9 2 1 0 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 4 0 4 7 0 1 0 5 2 0 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 99 84 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 97 54 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 142 111 35
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 39 (11.3%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 35 (10.14%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 13 (3.77%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 24 (6.96%)
Methionine (Met, M)
n = 17 (4.93%)
Proline (Pro, P)
n = 24 (6.96%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 20 11 3 19 32 9 2 6 3 0 8 4 1 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 4 18 16 1 0 6 4 1 0 11 11 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 2 3 12 9 1 1 6 1 6 2 2 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 3 2 0 1 9 5 0 2 1 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 109 109 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 123 58 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 153 133 23
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 39 (11.3%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 35 (10.14%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 13 (3.77%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 24 (6.96%)
Methionine (Met, M)
n = 17 (4.93%)
Proline (Pro, P)
n = 24 (6.96%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 20 11 3 19 32 9 2 6 3 0 8 4 1 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 4 18 16 1 0 6 4 1 0 11 11 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 2 3 12 9 1 1 6 1 6 2 2 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 3 2 0 1 9 5 0 2 1 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 109 109 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 123 58 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 153 133 23
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.59%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 47 (10.26%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 101 (22.05%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 26 (5.68%)
Proline (Pro, P)
n = 29 (6.33%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 1 (0.22%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 13 (2.84%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 30 21 8 21 53 13 5 11 0 1 5 4 1 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 2 20 9 1 1 7 11 2 4 13 9 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 19 2 2 14 13 0 0 9 4 10 1 1 2 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 4 0 1 8 2 0 2 8 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 160 145 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 137 73 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 193 188 42
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 3 3 1 9 4 1 2 0 0 0 4 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 0 6 3 0 0 4 2 0 0 2 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 2 1 5 1 0 4 0 1 1 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 1 2 0 1 0 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 30 24 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 28 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 45 35 8
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 34 (5.6%)
Alanine (Ala, A)
n = 58 (9.56%)
Serine (Ser, S)
n = 42 (6.92%)
Threonine (Thr, T)
n = 67 (11.04%)
Cysteine (Cys, C)
n = 7 (1.15%)
Valine (Val, V)
n = 21 (3.46%)
Leucine (Leu, L)
n = 107 (17.63%)
Isoleucine (Ile, I)
n = 49 (8.07%)
Methionine (Met, M)
n = 26 (4.28%)
Proline (Pro, P)
n = 31 (5.11%)
Phenylalanine (Phe, F)
n = 33 (5.44%)
Tyrosine (Tyr, Y)
n = 11 (1.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 6 (0.99%)
Glutamic acid (Glu, E)
n = 14 (2.31%)
Asparagine (Asn, N)
n = 23 (3.79%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 23 (3.79%)
Arginine (Arg, R)
n = 11 (1.81%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 40 19 5 33 53 11 5 12 6 1 7 12 1 9 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 6 5 35 16 2 0 15 13 6 1 15 14 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 22 0 3 20 7 1 1 10 2 9 4 0 3 20 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 11 3 0 6 21 2 1 5 4 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
133 176 199 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 187 110 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 292 218 53
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 35 (20.23%)
Leucine (Leu, L)
n = 27 (15.61%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 13 (7.51%)
Tyrosine (Tyr, Y)
n = 6 (3.47%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 0 3 2 1 4 7 0 0 15 1 9 10 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 5 2 5 5 3 3 2 19 2 0 0 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 0 0 4 2 1 4 2 3 10 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 3 0 0 0 2 0 0 4 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 21 16 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 33 15 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
70 13 27 64
Total protein-coding genes (size: 11406 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 224 (5.89%)
Alanine (Ala, A)
n = 335 (8.82%)
Serine (Ser, S)
n = 281 (7.39%)
Threonine (Thr, T)
n = 312 (8.21%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 196 (5.16%)
Leucine (Leu, L)
n = 667 (17.55%)
Isoleucine (Ile, I)
n = 279 (7.34%)
Methionine (Met, M)
n = 164 (4.32%)
Proline (Pro, P)
n = 231 (6.08%)
Phenylalanine (Phe, F)
n = 221 (5.82%)
Tyrosine (Tyr, Y)
n = 106 (2.79%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 60 (1.58%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 121 (3.18%)
Glutamine (Gln, Q)
n = 90 (2.37%)
Histidine (His, H)
n = 109 (2.87%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 74 (1.95%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
57 222 107 48 176 300 90 35 71 19 29 66 73 28 54 167
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
57 5 24 40 190 94 11 11 80 82 51 26 100 91 14 35
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
143 123 11 26 91 93 13 6 52 23 83 16 18 14 107 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
101 72 23 9 51 78 12 4 16 38 16 0 2 7 1 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
910 1118 1026 747
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
494 1101 679 1527
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
382 1669 1355 395

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.