Viewing data for Lepidosiren paradoxa


Scientific name Lepidosiren paradoxa
Common name South American lungfish
Maximum lifespan 8.30 years (Lepidosiren paradoxa@AnAge)

Total mtDNA (size: 16403 bases) GC AT G C A T
Base content (bases) 6107 10296 3748 2359 5133 5163
Base content per 1 kb (bases) 372 628 228 144 313 315
Base content (%) 37.2% 62.8%
Total protein-coding genes (size: 11410 bases) GC AT G C A T
Base content (bases) 4157 7253 2702 1455 3746 3507
Base content per 1 kb (bases) 364 636 237 128 328 307
Base content (%) 36.4% 63.6%
D-loop (size: 974 bases) GC AT G C A T
Base content (bases) 359 615 211 148 325 290
Base content per 1 kb (bases) 369 631 217 152 334 298
Base content (%) 36.9% 63.1%
Total tRNA-coding genes (size: 1529 bases) GC AT G C A T
Base content (bases) 624 905 346 278 411 494
Base content per 1 kb (bases) 408 592 226 182 269 323
Base content (%) 40.8% 59.2%
Total rRNA-coding genes (size: 2508 bases) GC AT G C A T
Base content (bases) 968 1540 491 477 655 885
Base content per 1 kb (bases) 386 614 196 190 261 353
Base content (%) 38.6% 61.4%
12S rRNA gene (size: 930 bases) GC AT G C A T
Base content (bases) 379 551 199 180 237 314
Base content per 1 kb (bases) 408 592 214 194 255 338
Base content (%) 40.8% 59.2%
16S rRNA gene (size: 1578 bases) GC AT G C A T
Base content (bases) 589 989 292 297 418 571
Base content per 1 kb (bases) 373 627 185 188 265 362
Base content (%) 37.3% 62.7%

ATP6 (size: 711 bases) GC AT G C A T
Base content (bases) 262 449 182 80 243 206
Base content per 1 kb (bases) 368 632 256 113 342 290
Base content (%) 36.8% 63.2%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 48 117 38 10 57 60
Base content per 1 kb (bases) 291 709 230 61 345 364
Base content (%) 29.1% 70.9%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 604 950 349 255 507 443
Base content per 1 kb (bases) 389 611 225 164 326 285
Base content (%) 38.9% 61.1%
COX2 (size: 699 bases) GC AT G C A T
Base content (bases) 262 437 161 101 208 229
Base content per 1 kb (bases) 375 625 230 144 298 328
Base content (%) 37.5% 62.5%
COX3 (size: 837 bases) GC AT G C A T
Base content (bases) 330 507 207 123 264 243
Base content per 1 kb (bases) 394 606 247 147 315 290
Base content (%) 39.4% 60.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 433 707 292 141 368 339
Base content per 1 kb (bases) 380 620 256 124 323 297
Base content (%) 38.0% 62.0%
ND1 (size: 969 bases) GC AT G C A T
Base content (bases) 336 633 215 121 339 294
Base content per 1 kb (bases) 347 653 222 125 350 303
Base content (%) 34.7% 65.3%
ND2 (size: 1032 bases) GC AT G C A T
Base content (bases) 354 678 239 115 355 323
Base content per 1 kb (bases) 343 657 232 111 344 313
Base content (%) 34.3% 65.7%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 129 222 73 56 133 89
Base content per 1 kb (bases) 368 632 208 160 379 254
Base content (%) 36.8% 63.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 463 915 306 157 467 448
Base content per 1 kb (bases) 336 664 222 114 339 325
Base content (%) 33.6% 66.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 125 172 88 37 97 75
Base content per 1 kb (bases) 421 579 296 125 327 253
Base content (%) 42.1% 57.9%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 649 1181 431 218 619 562
Base content per 1 kb (bases) 355 645 236 119 338 307
Base content (%) 35.5% 64.5%
ND6 (size: 510 bases) GC AT G C A T
Base content (bases) 186 324 136 50 105 219
Base content per 1 kb (bases) 365 635 267 98 206 429
Base content (%) 36.5% 63.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 12 (5.29%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 53 (23.35%)
Isoleucine (Ile, I)
n = 24 (10.57%)
Methionine (Met, M)
n = 7 (3.08%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 6 5 16 5 10 1 20 9 1 1 5 7 1 10 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 3 7 1 1 3 2 2 4 5 5 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 2 2 3 1 2 2 1 4 0 1 8 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 1 0 2 0 1 1 2 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 65 70 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 62 35 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 46 93 77
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPNPWFMILVISWLTLLLILFPKITSFTLFSNPEQKLLSMKTKSWTWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (11.11%)
Threonine (Thr, T)
n = 5 (9.26%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.85%)
Leucine (Leu, L)
n = 10 (18.52%)
Isoleucine (Ile, I)
n = 4 (7.41%)
Methionine (Met, M)
n = 3 (5.56%)
Proline (Pro, P)
n = 6 (11.11%)
Phenylalanine (Phe, F)
n = 4 (7.41%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.85%)
Asparagine (Asn, N)
n = 3 (5.56%)
Glutamine (Gln, Q)
n = 2 (3.7%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.41%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 2 2 1 2 0 5 2 0 0 0 1 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 0 0 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 0 0 1 3 1 0 1 0 0 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 13 20 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 16 11 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 9 29 15
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.28%)
Alanine (Ala, A)
n = 44 (8.51%)
Serine (Ser, S)
n = 28 (5.42%)
Threonine (Thr, T)
n = 41 (7.93%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.54%)
Leucine (Leu, L)
n = 61 (11.8%)
Isoleucine (Ile, I)
n = 40 (7.74%)
Methionine (Met, M)
n = 28 (5.42%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 16 (3.09%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 20 (3.87%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 9 27 20 5 15 1 20 8 0 16 7 14 2 29 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 11 17 16 0 10 7 23 8 6 3 15 4 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 21 1 6 5 13 0 1 3 9 7 0 0 11 4 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 2 4 11 8 0 0 1 6 1 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
157 105 136 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 107 213 178
COX2 (size: 699 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.45%)
Alanine (Ala, A)
n = 16 (6.9%)
Serine (Ser, S)
n = 17 (7.33%)
Threonine (Thr, T)
n = 16 (6.9%)
Cysteine (Cys, C)
n = 2 (0.86%)
Valine (Val, V)
n = 15 (6.47%)
Leucine (Leu, L)
n = 30 (12.93%)
Isoleucine (Ile, I)
n = 21 (9.05%)
Methionine (Met, M)
n = 11 (4.74%)
Proline (Pro, P)
n = 13 (5.6%)
Phenylalanine (Phe, F)
n = 9 (3.88%)
Tyrosine (Tyr, Y)
n = 9 (3.88%)
Tryptophan (Trp, W)
n = 5 (2.16%)
Aspartic acid (Asp, D)
n = 11 (4.74%)
Glutamic acid (Glu, E)
n = 15 (6.47%)
Asparagine (Asn, N)
n = 6 (2.59%)
Glutamine (Gln, Q)
n = 10 (4.31%)
Histidine (His, H)
n = 8 (3.45%)
Lysine (Lys, K)
n = 4 (1.72%)
Arginine (Arg, R)
n = 6 (2.59%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 4 9 6 4 10 0 10 8 2 4 2 9 0 8 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 3 5 6 2 2 4 1 1 4 0 8 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 0 4 3 7 0 1 2 4 5 1 0 4 2 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 13 2 5 6 4 0 1 1 4 0 1 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 57 62 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 59 63 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 45 104 73
COX3 (size: 837 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (7.55%)
Alanine (Ala, A)
n = 19 (6.83%)
Serine (Ser, S)
n = 18 (6.47%)
Threonine (Thr, T)
n = 25 (8.99%)
Cysteine (Cys, C)
n = 2 (0.72%)
Valine (Val, V)
n = 18 (6.47%)
Leucine (Leu, L)
n = 36 (12.95%)
Isoleucine (Ile, I)
n = 12 (4.32%)
Methionine (Met, M)
n = 10 (3.6%)
Proline (Pro, P)
n = 13 (4.68%)
Phenylalanine (Phe, F)
n = 25 (8.99%)
Tyrosine (Tyr, Y)
n = 12 (4.32%)
Tryptophan (Trp, W)
n = 12 (4.32%)
Aspartic acid (Asp, D)
n = 6 (2.16%)
Glutamic acid (Glu, E)
n = 9 (3.24%)
Asparagine (Asn, N)
n = 6 (2.16%)
Glutamine (Gln, Q)
n = 11 (3.96%)
Histidine (His, H)
n = 16 (5.76%)
Lysine (Lys, K)
n = 2 (0.72%)
Arginine (Arg, R)
n = 5 (1.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 2 9 13 4 10 1 8 11 0 7 5 6 0 18 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 5 3 11 0 1 9 11 0 1 4 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 0 2 1 10 0 2 3 5 7 3 0 4 2 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 0 2 4 2 0 3 1 1 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 73 60 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 70 63 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 64 120 90
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (5.8%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 15 (3.96%)
Leucine (Leu, L)
n = 68 (17.94%)
Isoleucine (Ile, I)
n = 32 (8.44%)
Methionine (Met, M)
n = 17 (4.49%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 11 15 18 12 20 4 11 7 2 5 1 9 0 21 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 4 9 13 0 3 7 9 3 3 2 15 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 13 1 5 3 15 0 1 2 5 8 0 3 8 10 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 1 2 7 9 0 2 0 6 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 104 103 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 94 77 163
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 94 159 110
ND1 (size: 969 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.59%)
Alanine (Ala, A)
n = 23 (7.14%)
Serine (Ser, S)
n = 28 (8.7%)
Threonine (Thr, T)
n = 19 (5.9%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.66%)
Leucine (Leu, L)
n = 55 (17.08%)
Isoleucine (Ile, I)
n = 31 (9.63%)
Methionine (Met, M)
n = 19 (5.9%)
Proline (Pro, P)
n = 20 (6.21%)
Phenylalanine (Phe, F)
n = 19 (5.9%)
Tyrosine (Tyr, Y)
n = 13 (4.04%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 13 (4.04%)
Glutamine (Gln, Q)
n = 7 (2.17%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 9 (2.8%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 4 16 8 7 11 0 28 7 0 4 1 10 0 15 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 5 13 5 0 3 5 4 6 7 5 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 6 2 6 5 15 0 1 1 9 4 0 1 8 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 3 0 9 0 0 3 3 2 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 64 93 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 88 60 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 63 141 104
ND2 (size: 1032 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.96%)
Alanine (Ala, A)
n = 26 (7.58%)
Serine (Ser, S)
n = 33 (9.62%)
Threonine (Thr, T)
n = 29 (8.45%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.75%)
Leucine (Leu, L)
n = 71 (20.7%)
Isoleucine (Ile, I)
n = 32 (9.33%)
Methionine (Met, M)
n = 20 (5.83%)
Proline (Pro, P)
n = 18 (5.25%)
Phenylalanine (Phe, F)
n = 16 (4.66%)
Tyrosine (Tyr, Y)
n = 9 (2.62%)
Tryptophan (Trp, W)
n = 11 (3.21%)
Aspartic acid (Asp, D)
n = 4 (1.17%)
Glutamic acid (Glu, E)
n = 4 (1.17%)
Asparagine (Asn, N)
n = 18 (5.25%)
Glutamine (Gln, Q)
n = 9 (2.62%)
Histidine (His, H)
n = 5 (1.46%)
Lysine (Lys, K)
n = 10 (2.92%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 3 18 15 7 22 4 21 8 1 0 2 4 0 14 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 11 7 6 2 5 2 7 3 3 2 10 3 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 1 7 6 16 0 3 1 6 3 0 2 12 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 2 2 9 1 1 1 1 1 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 84 113 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 102 60 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 53 150 120
ND3 (size: 1032 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.96%)
Alanine (Ala, A)
n = 26 (7.58%)
Serine (Ser, S)
n = 33 (9.62%)
Threonine (Thr, T)
n = 29 (8.45%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.75%)
Leucine (Leu, L)
n = 71 (20.7%)
Isoleucine (Ile, I)
n = 32 (9.33%)
Methionine (Met, M)
n = 20 (5.83%)
Proline (Pro, P)
n = 18 (5.25%)
Phenylalanine (Phe, F)
n = 16 (4.66%)
Tyrosine (Tyr, Y)
n = 9 (2.62%)
Tryptophan (Trp, W)
n = 11 (3.21%)
Aspartic acid (Asp, D)
n = 4 (1.17%)
Glutamic acid (Glu, E)
n = 4 (1.17%)
Asparagine (Asn, N)
n = 18 (5.25%)
Glutamine (Gln, Q)
n = 9 (2.62%)
Histidine (His, H)
n = 5 (1.46%)
Lysine (Lys, K)
n = 10 (2.92%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 3 18 15 7 22 4 21 8 1 0 2 4 0 14 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 11 7 6 2 5 2 7 3 3 2 10 3 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 1 7 6 16 0 3 1 6 3 0 2 12 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 2 2 9 1 1 1 1 1 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 84 113 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 102 60 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 53 150 120
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (4.8%)
Alanine (Ala, A)
n = 24 (5.24%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 40 (8.73%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 87 (19.0%)
Isoleucine (Ile, I)
n = 58 (12.66%)
Methionine (Met, M)
n = 29 (6.33%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 19 (4.15%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 16 (3.49%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 13 (2.84%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
46 12 25 14 9 27 3 31 10 2 5 1 5 0 16 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 1 8 5 10 1 6 4 9 3 5 4 12 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 22 1 4 7 18 0 6 5 10 6 2 3 9 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 3 1 3 12 0 0 5 6 0 0 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 107 163 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 114 77 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 85 208 144
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 26 (26.53%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 3 (3.06%)
Proline (Pro, P)
n = 5 (5.1%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 2 7 2 5 3 9 1 0 0 0 3 0 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 1 3 5 0 0 0 2 2 0 2 3 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 2 4 4 0 0 1 0 0 0 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 1 1 0 0 2 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 29 21 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 34 11 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 25 43 25
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.93%)
Alanine (Ala, A)
n = 44 (7.22%)
Serine (Ser, S)
n = 56 (9.2%)
Threonine (Thr, T)
n = 54 (8.87%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 17 (2.79%)
Leucine (Leu, L)
n = 103 (16.91%)
Isoleucine (Ile, I)
n = 59 (9.69%)
Methionine (Met, M)
n = 29 (4.76%)
Proline (Pro, P)
n = 23 (3.78%)
Phenylalanine (Phe, F)
n = 49 (8.05%)
Tyrosine (Tyr, Y)
n = 11 (1.81%)
Tryptophan (Trp, W)
n = 14 (2.3%)
Aspartic acid (Asp, D)
n = 12 (1.97%)
Glutamic acid (Glu, E)
n = 12 (1.97%)
Asparagine (Asn, N)
n = 31 (5.09%)
Glutamine (Gln, Q)
n = 17 (2.79%)
Histidine (His, H)
n = 14 (2.3%)
Lysine (Lys, K)
n = 21 (3.45%)
Arginine (Arg, R)
n = 8 (1.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
47 12 25 28 8 28 3 30 15 2 5 3 8 1 36 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 3 8 18 16 2 1 8 13 8 4 4 14 1 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 23 0 13 9 23 1 5 5 7 4 1 6 15 16 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 3 4 8 18 3 2 2 4 0 0 0 0 1 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
115 129 204 162
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 167 119 257
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 135 239 200
ND6 (size: 510 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.43%)
Alanine (Ala, A)
n = 11 (6.51%)
Serine (Ser, S)
n = 13 (7.69%)
Threonine (Thr, T)
n = 2 (1.18%)
Cysteine (Cys, C)
n = 3 (1.78%)
Valine (Val, V)
n = 25 (14.79%)
Leucine (Leu, L)
n = 27 (15.98%)
Isoleucine (Ile, I)
n = 9 (5.33%)
Methionine (Met, M)
n = 12 (7.1%)
Proline (Pro, P)
n = 4 (2.37%)
Phenylalanine (Phe, F)
n = 11 (6.51%)
Tyrosine (Tyr, Y)
n = 7 (4.14%)
Tryptophan (Trp, W)
n = 8 (4.73%)
Aspartic acid (Asp, D)
n = 3 (1.78%)
Glutamic acid (Glu, E)
n = 7 (4.14%)
Asparagine (Asn, N)
n = 2 (1.18%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.59%)
Arginine (Arg, R)
n = 3 (1.78%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 1 5 4 0 3 0 16 0 0 15 1 7 2 11 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 3 0 4 3 2 2 7 2 5 7 2 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 6 0 3 1 3 0 6 1 0 4 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 4 3 0 0 1 0 0 1 2 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 14 29 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 27 21 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 9 55 75
Total protein-coding genes (size: 11446 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 227 (5.95%)
Alanine (Ala, A)
n = 264 (6.92%)
Serine (Ser, S)
n = 295 (7.73%)
Threonine (Thr, T)
n = 295 (7.73%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 182 (4.77%)
Leucine (Leu, L)
n = 653 (17.12%)
Isoleucine (Ile, I)
n = 339 (8.89%)
Methionine (Met, M)
n = 191 (5.01%)
Proline (Pro, P)
n = 195 (5.11%)
Phenylalanine (Phe, F)
n = 250 (6.55%)
Tyrosine (Tyr, Y)
n = 113 (2.96%)
Tryptophan (Trp, W)
n = 117 (3.07%)
Aspartic acid (Asp, D)
n = 72 (1.89%)
Glutamic acid (Glu, E)
n = 98 (2.57%)
Asparagine (Asn, N)
n = 139 (3.64%)
Glutamine (Gln, Q)
n = 98 (2.57%)
Histidine (His, H)
n = 94 (2.46%)
Lysine (Lys, K)
n = 85 (2.23%)
Arginine (Arg, R)
n = 71 (1.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
272 67 160 159 65 166 21 222 87 11 62 29 85 6 193 57
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
31 14 11 66 89 97 12 41 53 88 45 39 32 111 13 86
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
64 139 6 61 49 131 3 26 25 64 49 9 20 84 55 46
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
48 81 17 28 44 79 6 11 18 35 7 1 0 7 4 108
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
843 869 1101 1002
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
492 998 710 1615
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
211 755 1597 1252

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.