Viewing data for Anguilla australis


Scientific name Anguilla australis
Common name Shortfin eel
Maximum lifespan 32.00 years (Anguilla australis@AnAge)

Total mtDNA (size: 16686 bases) GC AT G C A T
Base content (bases) 6860 9826 4306 2554 4163 5663
Base content per 1 kb (bases) 411 589 258 153 249 339
Base content (%) 41.1% 58.9%
Total protein-coding genes (size: 11447 bases) GC AT G C A T
Base content (bases) 4708 6739 3108 1600 2962 3777
Base content per 1 kb (bases) 411 589 272 140 259 330
Base content (%) 41.1% 58.9%
D-loop (size: 966 bases) GC AT G C A T
Base content (bases) 290 676 179 111 296 380
Base content per 1 kb (bases) 300 700 185 115 306 393
Base content (%) 30.0% 70.0%
Total tRNA-coding genes (size: 1563 bases) GC AT G C A T
Base content (bases) 679 884 378 301 386 498
Base content per 1 kb (bases) 434 566 242 193 247 319
Base content (%) 43.4% 56.6%
Total rRNA-coding genes (size: 2656 bases) GC AT G C A T
Base content (bases) 1159 1497 629 530 507 990
Base content per 1 kb (bases) 436 564 237 200 191 373
Base content (%) 43.6% 56.4%
12S rRNA gene (size: 947 bases) GC AT G C A T
Base content (bases) 442 505 240 202 184 321
Base content per 1 kb (bases) 467 533 253 213 194 339
Base content (%) 46.7% 53.3%
16S rRNA gene (size: 1709 bases) GC AT G C A T
Base content (bases) 717 992 389 328 323 669
Base content per 1 kb (bases) 420 580 228 192 189 391
Base content (%) 42.0% 58.0%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 270 413 184 86 197 216
Base content per 1 kb (bases) 395 605 269 126 288 316
Base content (%) 39.5% 60.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 47 22 38 61
Base content per 1 kb (bases) 411 589 280 131 226 363
Base content (%) 41.1% 58.9%
COX1 (size: 1593 bases) GC AT G C A T
Base content (bases) 679 914 397 282 461 453
Base content per 1 kb (bases) 426 574 249 177 289 284
Base content (%) 42.6% 57.4%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 295 396 177 118 175 221
Base content per 1 kb (bases) 427 573 256 171 253 320
Base content (%) 42.7% 57.3%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 339 446 214 125 205 241
Base content per 1 kb (bases) 432 568 273 159 261 307
Base content (%) 43.2% 56.8%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 487 653 324 163 313 340
Base content per 1 kb (bases) 427 573 284 143 275 298
Base content (%) 42.7% 57.3%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 407 565 283 124 244 321
Base content per 1 kb (bases) 419 581 291 128 251 330
Base content (%) 41.9% 58.1%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 408 637 288 120 228 409
Base content per 1 kb (bases) 390 610 276 115 218 391
Base content (%) 39.0% 61.0%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 149 200 97 52 105 95
Base content per 1 kb (bases) 427 573 278 149 301 272
Base content (%) 42.7% 57.3%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 556 825 370 186 366 459
Base content per 1 kb (bases) 403 597 268 135 265 332
Base content (%) 40.3% 59.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 127 170 87 40 87 83
Base content per 1 kb (bases) 428 572 293 135 293 279
Base content (%) 42.8% 57.2%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 721 1121 493 228 469 652
Base content per 1 kb (bases) 391 609 268 124 255 354
Base content (%) 39.1% 60.9%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 206 316 150 56 80 236
Base content per 1 kb (bases) 395 605 287 107 153 452
Base content (%) 39.5% 60.5%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 10 (4.42%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (7.96%)
Leucine (Leu, L)
n = 51 (22.57%)
Isoleucine (Ile, I)
n = 16 (7.08%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 16 (7.08%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 11 7 5 26 3 9 9 0 4 3 11 0 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 3 8 0 3 1 5 1 3 2 10 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 14 0 2 2 0 0 1 5 3 2 2 1 4 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 1 1 0 1 0 5 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 75 68 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 58 31 111
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 51 116 49
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFMILVFSWAVFLAILPTKVMAHTFNNEPSQQTAKKPKMDSWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 4 (7.27%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 2 0 1 1 0 2 2 1 0 0 2 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 2 2 0 0 0 0 0 0 3 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 0 1 1 0 0 1 0 1 1 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 0 1 4 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 13 18 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 17 16 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 17 27 6
COX1 (size: 1593 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.06%)
Alanine (Ala, A)
n = 46 (8.68%)
Serine (Ser, S)
n = 28 (5.28%)
Threonine (Thr, T)
n = 38 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.3%)
Leucine (Leu, L)
n = 62 (11.7%)
Isoleucine (Ile, I)
n = 39 (7.36%)
Methionine (Met, M)
n = 23 (4.34%)
Proline (Pro, P)
n = 30 (5.66%)
Phenylalanine (Phe, F)
n = 41 (7.74%)
Tyrosine (Tyr, Y)
n = 19 (3.58%)
Tryptophan (Trp, W)
n = 18 (3.4%)
Aspartic acid (Asp, D)
n = 17 (3.21%)
Glutamic acid (Glu, E)
n = 14 (2.64%)
Asparagine (Asn, N)
n = 14 (2.64%)
Glutamine (Gln, Q)
n = 9 (1.7%)
Histidine (His, H)
n = 19 (3.58%)
Lysine (Lys, K)
n = 11 (2.08%)
Arginine (Arg, R)
n = 9 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 14 13 12 5 30 4 10 9 0 9 7 24 4 20 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 0 11 19 14 2 10 9 23 6 6 3 19 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 20 0 5 7 11 1 1 3 7 12 0 1 7 7 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 14 0 6 11 11 0 4 0 4 1 0 1 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
169 118 130 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 138 103 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 141 220 138
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 20 (8.73%)
Serine (Ser, S)
n = 13 (5.68%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 27 (11.79%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 8 5 2 12 2 5 8 1 4 5 10 2 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 0 6 13 1 2 0 6 1 1 5 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 2 1 6 1 0 3 6 3 0 1 0 5 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 2 3 10 3 0 0 1 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 60 52 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 63 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 63 106 45
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 26 (10.0%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 29 (11.15%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 6 8 4 1 21 0 3 9 0 3 5 10 0 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 1 12 8 0 2 5 13 1 1 1 9 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 14 0 1 1 8 0 0 3 7 5 2 0 0 1 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 2 2 3 3 0 0 0 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 67 56 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 69 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 78 129 47
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 29 (7.65%)
Leucine (Leu, L)
n = 61 (16.09%)
Isoleucine (Ile, I)
n = 24 (6.33%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 10 12 8 12 26 5 10 6 0 4 4 18 3 8 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 4 14 9 0 3 5 17 1 2 0 20 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 9 0 3 7 12 1 0 0 4 12 1 0 3 18 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 1 2 9 8 1 1 0 7 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 99 88 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 92 81 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 133 171 61
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.57%)
Alanine (Ala, A)
n = 34 (10.53%)
Serine (Ser, S)
n = 18 (5.57%)
Threonine (Thr, T)
n = 22 (6.81%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (4.95%)
Leucine (Leu, L)
n = 60 (18.58%)
Isoleucine (Ile, I)
n = 24 (7.43%)
Methionine (Met, M)
n = 16 (4.95%)
Proline (Pro, P)
n = 24 (7.43%)
Phenylalanine (Phe, F)
n = 16 (4.95%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.72%)
Asparagine (Asn, N)
n = 16 (4.95%)
Glutamine (Gln, Q)
n = 5 (1.55%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 13 14 11 6 31 1 11 4 1 2 3 11 0 6 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 19 13 0 0 6 12 0 3 3 18 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 1 0 4 12 0 0 2 5 7 0 0 2 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 12 0 0 3 8 0 1 1 6 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 89 88 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 96 60 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 98 173 48
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 32 (9.22%)
Serine (Ser, S)
n = 18 (5.19%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 56 (16.14%)
Isoleucine (Ile, I)
n = 28 (8.07%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 16 28 3 6 39 1 5 14 0 1 1 7 0 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 3 16 13 0 1 4 12 2 2 2 16 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 36 0 2 1 11 0 2 2 3 5 0 2 4 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 0 2 13 0 0 0 3 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 94 136 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 113 59 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 81 214 40
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 32 (9.22%)
Serine (Ser, S)
n = 18 (5.19%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 56 (16.14%)
Isoleucine (Ile, I)
n = 28 (8.07%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 16 28 3 6 39 1 5 14 0 1 1 7 0 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 3 16 13 0 1 4 12 2 2 2 16 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 36 0 2 1 11 0 2 2 3 5 0 2 4 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 0 2 13 0 0 0 3 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 94 136 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 113 59 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 81 214 40
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 34 (7.41%)
Serine (Ser, S)
n = 28 (6.1%)
Threonine (Thr, T)
n = 39 (8.5%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 17 (3.7%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 43 (9.37%)
Methionine (Met, M)
n = 29 (6.32%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.83%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 19 26 7 11 46 3 19 10 1 1 3 12 1 5 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 5 5 12 15 2 3 8 14 4 3 5 16 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 16 1 5 5 13 0 2 3 8 7 1 0 2 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 12 0 2 3 11 2 1 2 9 0 0 0 0 0 19
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 124 142 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 120 79 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 126 238 78
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 6 2 2 8 1 6 2 0 0 0 3 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 2 7 4 0 0 3 1 0 0 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 1 4 4 0 1 1 0 1 1 1 1 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 1 0 1 0 1 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 24 21 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 32 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 31 46 18
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 51 (8.32%)
Serine (Ser, S)
n = 35 (5.71%)
Threonine (Thr, T)
n = 54 (8.81%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 32 (5.22%)
Leucine (Leu, L)
n = 87 (14.19%)
Isoleucine (Ile, I)
n = 50 (8.16%)
Methionine (Met, M)
n = 41 (6.69%)
Proline (Pro, P)
n = 30 (4.89%)
Phenylalanine (Phe, F)
n = 40 (6.53%)
Tyrosine (Tyr, Y)
n = 13 (2.12%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 34 (5.55%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 13 (2.12%)
Lysine (Lys, K)
n = 26 (4.24%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 28 35 13 11 45 2 15 22 0 6 9 17 0 12 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 3 11 18 21 1 4 6 19 2 2 5 23 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 32 1 5 3 15 1 1 10 2 11 1 1 7 27 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 1 5 8 26 0 0 0 7 2 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
139 145 216 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 159 134 250
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 189 302 105
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 5 (2.89%)
Valine (Val, V)
n = 18 (10.4%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 10 (5.78%)
Methionine (Met, M)
n = 5 (2.89%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 13 (7.51%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 0 2 7 0 0 0 13 0 0 8 1 4 5 13 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 5 0 10 2 4 0 8 1 4 12 2 0 1 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 5 0 2 1 2 1 11 2 2 8 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 4 5 0 0 0 4 0 1 1 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 17 21 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 30 25 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 9 34 93
Total protein-coding genes (size: 11468 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 246 (6.44%)
Alanine (Ala, A)
n = 320 (8.38%)
Serine (Ser, S)
n = 219 (5.73%)
Threonine (Thr, T)
n = 299 (7.83%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 233 (6.1%)
Leucine (Leu, L)
n = 593 (15.53%)
Isoleucine (Ile, I)
n = 280 (7.33%)
Methionine (Met, M)
n = 214 (5.6%)
Proline (Pro, P)
n = 214 (5.6%)
Phenylalanine (Phe, F)
n = 231 (6.05%)
Tyrosine (Tyr, Y)
n = 126 (3.3%)
Tryptophan (Trp, W)
n = 121 (3.17%)
Aspartic acid (Asp, D)
n = 82 (2.15%)
Glutamic acid (Glu, E)
n = 104 (2.72%)
Asparagine (Asn, N)
n = 130 (3.4%)
Glutamine (Gln, Q)
n = 102 (2.67%)
Histidine (His, H)
n = 99 (2.59%)
Lysine (Lys, K)
n = 93 (2.44%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
155 125 166 85 64 296 24 109 98 4 42 43 130 18 93 138
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
48 12 18 56 131 127 6 36 49 130 31 26 32 151 5 40
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
88 167 4 31 39 100 5 10 34 56 70 11 15 33 97 38
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
61 94 10 28 54 90 3 13 5 53 6 0 1 5 1 110
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
985 961 1061 813
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
519 1008 742 1551
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
192 1048 1826 754

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.