Viewing data for Anguilla dieffenbachii


Scientific name Anguilla dieffenbachii
Common name New Zealand longfin eel
Maximum lifespan 60.00 years (Anguilla dieffenbachii@AnAge)

Total mtDNA (size: 16687 bases) GC AT G C A T
Base content (bases) 6840 9847 4248 2592 4199 5648
Base content per 1 kb (bases) 410 590 255 155 252 338
Base content (%) 41.0% 59.0%
Total protein-coding genes (size: 11447 bases) GC AT G C A T
Base content (bases) 4698 6749 3060 1638 2992 3757
Base content per 1 kb (bases) 410 590 267 143 261 328
Base content (%) 41.0% 59.0%
D-loop (size: 961 bases) GC AT G C A T
Base content (bases) 293 668 181 112 286 382
Base content per 1 kb (bases) 305 695 188 117 298 398
Base content (%) 30.5% 69.5%
Total tRNA-coding genes (size: 1562 bases) GC AT G C A T
Base content (bases) 672 890 378 294 387 503
Base content per 1 kb (bases) 430 570 242 188 248 322
Base content (%) 43.0% 57.0%
Total rRNA-coding genes (size: 2658 bases) GC AT G C A T
Base content (bases) 1152 1506 617 535 522 984
Base content per 1 kb (bases) 433 567 232 201 196 370
Base content (%) 43.3% 56.7%
12S rRNA gene (size: 947 bases) GC AT G C A T
Base content (bases) 441 506 240 201 185 321
Base content per 1 kb (bases) 466 534 253 212 195 339
Base content (%) 46.6% 53.4%
16S rRNA gene (size: 1711 bases) GC AT G C A T
Base content (bases) 711 1000 377 334 337 663
Base content per 1 kb (bases) 416 584 220 195 197 387
Base content (%) 41.6% 58.4%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 271 412 184 87 194 218
Base content per 1 kb (bases) 397 603 269 127 284 319
Base content (%) 39.7% 60.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 49 21 38 60
Base content per 1 kb (bases) 417 583 292 125 226 357
Base content (%) 41.7% 58.3%
COX1 (size: 1593 bases) GC AT G C A T
Base content (bases) 685 908 400 285 452 456
Base content per 1 kb (bases) 430 570 251 179 284 286
Base content (%) 43.0% 57.0%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 288 403 174 114 176 227
Base content per 1 kb (bases) 417 583 252 165 255 329
Base content (%) 41.7% 58.3%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 345 440 215 130 208 232
Base content per 1 kb (bases) 439 561 274 166 265 296
Base content (%) 43.9% 56.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 472 668 314 158 317 351
Base content per 1 kb (bases) 414 586 275 139 278 308
Base content (%) 41.4% 58.6%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 399 573 271 128 254 319
Base content per 1 kb (bases) 410 590 279 132 261 328
Base content (%) 41.0% 59.0%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 407 638 272 135 245 393
Base content per 1 kb (bases) 389 611 260 129 234 376
Base content (%) 38.9% 61.1%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 146 203 97 49 106 97
Base content per 1 kb (bases) 418 582 278 140 304 278
Base content (%) 41.8% 58.2%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 563 818 367 196 364 454
Base content per 1 kb (bases) 408 592 266 142 264 329
Base content (%) 40.8% 59.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 135 162 92 43 84 78
Base content per 1 kb (bases) 455 545 310 145 283 263
Base content (%) 45.5% 54.5%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 709 1133 473 236 487 646
Base content per 1 kb (bases) 385 615 257 128 264 351
Base content (%) 38.5% 61.5%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 213 309 155 58 73 236
Base content per 1 kb (bases) 408 592 297 111 140 452
Base content (%) 40.8% 59.2%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 10 (4.42%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 17 (7.52%)
Leucine (Leu, L)
n = 52 (23.01%)
Isoleucine (Ile, I)
n = 17 (7.52%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 16 (7.08%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 9 9 6 5 25 5 10 9 0 2 3 11 1 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 4 9 0 2 1 7 0 4 1 10 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 1 2 2 0 0 1 5 3 2 0 1 1 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 1 1 0 1 0 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 75 67 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 59 31 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 50 119 46
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFTILVFSWAVFLAILPTKVMAHTFNNEPNQQTAKKPKLDSWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 1 1 0 2 0 2 2 1 0 0 2 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 2 2 0 0 0 0 0 0 3 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 1 0 1 0 0 0 0 1 1 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 1 0 1 4 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 14 17 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 18 17 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 17 26 7
COX1 (size: 1593 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.06%)
Alanine (Ala, A)
n = 45 (8.49%)
Serine (Ser, S)
n = 27 (5.09%)
Threonine (Thr, T)
n = 39 (7.36%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.3%)
Leucine (Leu, L)
n = 62 (11.7%)
Isoleucine (Ile, I)
n = 39 (7.36%)
Methionine (Met, M)
n = 23 (4.34%)
Proline (Pro, P)
n = 30 (5.66%)
Phenylalanine (Phe, F)
n = 41 (7.74%)
Tyrosine (Tyr, Y)
n = 19 (3.58%)
Tryptophan (Trp, W)
n = 18 (3.4%)
Aspartic acid (Asp, D)
n = 16 (3.02%)
Glutamic acid (Glu, E)
n = 14 (2.64%)
Asparagine (Asn, N)
n = 15 (2.83%)
Glutamine (Gln, Q)
n = 9 (1.7%)
Histidine (His, H)
n = 20 (3.77%)
Lysine (Lys, K)
n = 11 (2.08%)
Arginine (Arg, R)
n = 9 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 18 15 11 5 29 6 11 9 0 8 7 26 3 19 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 10 19 14 2 7 10 23 8 7 3 19 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 19 1 5 5 11 2 2 2 11 8 0 0 7 8 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 12 2 5 11 10 1 3 0 4 2 0 1 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
167 119 132 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 137 104 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 144 220 130
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 19 (8.3%)
Serine (Ser, S)
n = 14 (6.11%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 27 (11.79%)
Isoleucine (Ile, I)
n = 17 (7.42%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 6 (2.62%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 9 11 5 2 11 2 7 8 1 3 5 11 2 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 0 5 13 1 1 1 6 1 2 3 8 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 0 2 2 6 1 0 3 6 3 0 0 2 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 13 1 3 10 3 0 0 1 4 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 59 52 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 64 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 61 111 45
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 26 (10.0%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 30 (11.54%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 8 2 4 17 2 5 8 1 4 4 7 3 8 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 1 12 7 0 2 6 11 2 1 2 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 14 0 1 1 6 2 0 3 7 5 2 0 0 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 0 2 3 3 0 0 1 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 66 57 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 81 119 48
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 30 (7.92%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 25 (6.6%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 20 (5.28%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 11 12 12 6 32 2 8 6 0 4 4 20 2 8 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 5 13 9 0 1 6 18 1 2 0 20 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 4 5 15 0 0 1 4 12 1 0 3 17 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 4 7 8 1 1 0 7 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
99 100 88 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 93 80 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 121 183 68
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.57%)
Alanine (Ala, A)
n = 34 (10.53%)
Serine (Ser, S)
n = 18 (5.57%)
Threonine (Thr, T)
n = 22 (6.81%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (4.95%)
Leucine (Leu, L)
n = 60 (18.58%)
Isoleucine (Ile, I)
n = 24 (7.43%)
Methionine (Met, M)
n = 16 (4.95%)
Proline (Pro, P)
n = 24 (7.43%)
Phenylalanine (Phe, F)
n = 16 (4.95%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.72%)
Asparagine (Asn, N)
n = 16 (4.95%)
Glutamine (Gln, Q)
n = 5 (1.55%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 8 13 10 6 31 1 10 5 0 2 2 12 0 7 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 18 12 0 2 4 10 2 2 4 18 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 0 3 13 0 0 2 7 5 0 2 3 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 12 0 0 3 8 0 1 1 5 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 88 88 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 96 60 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 87 171 57
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 33 (9.51%)
Serine (Ser, S)
n = 17 (4.9%)
Threonine (Thr, T)
n = 44 (12.68%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 37 (10.66%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 12 25 5 6 29 3 11 12 2 0 1 8 0 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 1 0 6 12 14 1 1 3 13 2 1 3 15 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 30 1 2 1 10 1 1 2 4 4 0 3 5 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 2 0 2 13 0 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 88 134 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 111 60 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 73 199 48
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 33 (9.51%)
Serine (Ser, S)
n = 17 (4.9%)
Threonine (Thr, T)
n = 44 (12.68%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 37 (10.66%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 12 25 5 6 29 3 11 12 2 0 1 8 0 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 1 0 6 12 14 1 1 3 13 2 1 3 15 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 30 1 2 1 10 1 1 2 4 4 0 3 5 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 2 0 2 13 0 0 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 88 134 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 111 60 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 73 199 48
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 34 (7.41%)
Serine (Ser, S)
n = 29 (6.32%)
Threonine (Thr, T)
n = 39 (8.5%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 17 (3.7%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 43 (9.37%)
Methionine (Met, M)
n = 29 (6.32%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 14 (3.05%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.83%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 17 24 6 12 44 4 18 11 0 1 2 13 1 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 4 3 14 15 2 2 7 14 6 1 6 17 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 1 4 8 11 1 0 5 7 8 2 2 4 9 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 11 1 2 3 11 2 1 2 8 1 0 0 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 123 142 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 121 79 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 123 233 76
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 5 2 2 9 2 4 2 0 0 0 3 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 2 7 4 0 1 2 0 1 0 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 0 1 4 4 0 1 1 0 1 0 1 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 1 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 26 21 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 32 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 34 41 17
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 51 (8.32%)
Serine (Ser, S)
n = 35 (5.71%)
Threonine (Thr, T)
n = 56 (9.14%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 30 (4.89%)
Leucine (Leu, L)
n = 86 (14.03%)
Isoleucine (Ile, I)
n = 53 (8.65%)
Methionine (Met, M)
n = 38 (6.2%)
Proline (Pro, P)
n = 30 (4.89%)
Phenylalanine (Phe, F)
n = 41 (6.69%)
Tyrosine (Tyr, Y)
n = 13 (2.12%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 34 (5.55%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 13 (2.12%)
Lysine (Lys, K)
n = 26 (4.24%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 25 30 11 10 43 4 17 21 1 11 3 15 1 17 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 5 1 10 19 21 1 3 7 19 2 3 3 24 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 34 2 4 4 15 1 0 11 3 10 3 1 9 25 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 1 5 8 25 1 0 0 7 2 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
137 142 218 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 161 134 248
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 170 294 122
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 5 (2.89%)
Valine (Val, V)
n = 19 (10.98%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 10 (5.78%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 13 (7.51%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 1 2 7 0 0 1 7 0 0 10 0 5 4 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 5 0 10 2 4 0 6 4 3 12 2 0 0 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 5 0 2 1 3 0 12 1 2 13 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 3 4 1 0 0 4 0 1 1 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 18 20 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 30 25 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 10 28 94
Total protein-coding genes (size: 11468 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 246 (6.44%)
Alanine (Ala, A)
n = 318 (8.33%)
Serine (Ser, S)
n = 220 (5.76%)
Threonine (Thr, T)
n = 301 (7.88%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 232 (6.07%)
Leucine (Leu, L)
n = 595 (15.58%)
Isoleucine (Ile, I)
n = 284 (7.44%)
Methionine (Met, M)
n = 207 (5.42%)
Proline (Pro, P)
n = 214 (5.6%)
Phenylalanine (Phe, F)
n = 229 (6.0%)
Tyrosine (Tyr, Y)
n = 126 (3.3%)
Tryptophan (Trp, W)
n = 121 (3.17%)
Aspartic acid (Asp, D)
n = 81 (2.12%)
Glutamic acid (Glu, E)
n = 104 (2.72%)
Asparagine (Asn, N)
n = 133 (3.48%)
Glutamine (Gln, Q)
n = 102 (2.67%)
Histidine (His, H)
n = 100 (2.62%)
Lysine (Lys, K)
n = 93 (2.44%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
163 121 158 83 61 283 35 110 96 6 45 33 135 19 100 129
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
49 17 13 57 128 126 7 29 51 129 37 27 31 149 7 42
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
87 164 8 31 38 99 9 8 35 65 61 11 23 39 94 41
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
59 92 12 27 54 88 5 12 6 51 8 0 1 5 1 110
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
981 955 1062 822
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
518 1010 745 1547
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
238 1001 1795 786

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.