Viewing data for Amia calva


Scientific name Amia calva
Common name Bowfin
Maximum lifespan 30.00 years (Amia calva@AnAge)

Total mtDNA (size: 16210 bases) GC AT G C A T
Base content (bases) 7060 9150 4545 2515 4171 4979
Base content per 1 kb (bases) 436 564 280 155 257 307
Base content (%) 43.6% 56.4%
Total protein-coding genes (size: 11406 bases) GC AT G C A T
Base content (bases) 5050 6356 3403 1647 2989 3367
Base content per 1 kb (bases) 443 557 298 144 262 295
Base content (%) 44.3% 55.7%
D-loop (size: 488 bases) GC AT G C A T
Base content (bases) 123 365 82 41 181 184
Base content per 1 kb (bases) 252 748 168 84 371 377
Base content (%) 25.2% 74.8%
Total tRNA-coding genes (size: 1562 bases) GC AT G C A T
Base content (bases) 688 874 390 298 392 482
Base content per 1 kb (bases) 440 560 250 191 251 309
Base content (%) 44.0% 56.0%
Total rRNA-coding genes (size: 2671 bases) GC AT G C A T
Base content (bases) 1165 1506 651 514 583 923
Base content per 1 kb (bases) 436 564 244 192 218 346
Base content (%) 43.6% 56.4%
12S rRNA gene (size: 963 bases) GC AT G C A T
Base content (bases) 438 525 237 201 213 312
Base content per 1 kb (bases) 455 545 246 209 221 324
Base content (%) 45.5% 54.5%
16S rRNA gene (size: 1708 bases) GC AT G C A T
Base content (bases) 727 981 414 313 370 611
Base content per 1 kb (bases) 426 574 242 183 217 358
Base content (%) 42.6% 57.4%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 289 395 206 83 194 201
Base content per 1 kb (bases) 423 577 301 121 284 294
Base content (%) 42.3% 57.7%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 75 93 55 20 39 54
Base content per 1 kb (bases) 446 554 327 119 232 321
Base content (%) 44.6% 55.4%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 722 829 435 287 419 410
Base content per 1 kb (bases) 466 534 280 185 270 264
Base content (%) 46.6% 53.4%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 299 389 186 113 180 209
Base content per 1 kb (bases) 435 565 270 164 262 304
Base content (%) 43.5% 56.5%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 357 429 227 130 205 224
Base content per 1 kb (bases) 454 546 289 165 261 285
Base content (%) 45.4% 54.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 499 641 332 167 330 311
Base content per 1 kb (bases) 438 562 291 146 289 273
Base content (%) 43.8% 56.2%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 433 542 302 131 259 283
Base content per 1 kb (bases) 444 556 310 134 266 290
Base content (%) 44.4% 55.6%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 451 594 326 125 266 328
Base content per 1 kb (bases) 432 568 312 120 255 314
Base content (%) 43.2% 56.8%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 161 188 110 51 99 89
Base content per 1 kb (bases) 461 539 315 146 284 255
Base content (%) 46.1% 53.9%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 617 764 416 201 367 397
Base content per 1 kb (bases) 447 553 301 146 266 287
Base content (%) 44.7% 55.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 148 149 103 45 77 72
Base content per 1 kb (bases) 498 502 347 152 259 242
Base content (%) 49.8% 50.2%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 783 1059 544 239 485 574
Base content per 1 kb (bases) 425 575 295 130 263 312
Base content (%) 42.5% 57.5%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 221 301 164 57 76 225
Base content per 1 kb (bases) 423 577 314 109 146 431
Base content (%) 42.3% 57.7%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 9 (3.96%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 50 (22.03%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 11 7 10 10 23 1 5 9 0 4 4 7 0 7 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 4 7 6 0 0 3 6 0 2 4 10 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 8 0 1 1 1 0 1 5 2 3 1 1 2 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 2 1 1 0 0 0 6 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 79 69 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 59 34 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 68 98 54
ATP8 (size: 168 bases)
Amino acid sequence: MPQLDLAPWVLYLLYSWMILLVVLTPKILGHTFPNEPTTQSAKKPETQSWAWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 9 (16.36%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 1 (1.82%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 1 (1.82%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 0 1 2 4 0 2 3 0 1 1 1 0 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 3 0 0 0 1 0 0 1 2 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 0 3 0 0 0 1 0 2 0 0 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 1 1 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 18 14 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 18 14 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 19 26 8
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 51 (9.88%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 34 (6.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 46 (8.91%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 32 (6.2%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 29 (5.62%)
Phenylalanine (Phe, F)
n = 40 (7.75%)
Tyrosine (Tyr, Y)
n = 21 (4.07%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 14 16 7 11 28 8 6 6 1 11 8 25 2 13 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 9 18 23 1 5 15 20 7 5 12 10 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 1 4 11 7 1 2 3 8 13 1 2 4 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 8 3 3 11 8 0 1 0 7 1 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
169 119 118 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 137 96 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 179 196 103
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 15 (6.58%)
Serine (Ser, S)
n = 15 (6.58%)
Threonine (Thr, T)
n = 14 (6.14%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 22 (9.65%)
Leucine (Leu, L)
n = 25 (10.96%)
Isoleucine (Ile, I)
n = 17 (7.46%)
Methionine (Met, M)
n = 14 (6.14%)
Proline (Pro, P)
n = 13 (5.7%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 16 (7.02%)
Glutamic acid (Glu, E)
n = 12 (5.26%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 9 (3.95%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 6 11 5 4 13 0 3 8 1 2 9 9 2 7 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 6 4 1 0 0 6 2 3 2 5 3 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 1 3 5 3 0 1 3 2 6 0 0 2 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 0 5 11 3 1 0 3 2 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 60 57 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 53 63 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 73 89 52
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 26 (9.96%)
Serine (Ser, S)
n = 11 (4.21%)
Threonine (Thr, T)
n = 22 (8.43%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.13%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 16 (6.13%)
Methionine (Met, M)
n = 7 (2.68%)
Proline (Pro, P)
n = 11 (4.21%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 11 (4.21%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.07%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 9 (3.45%)
Histidine (His, H)
n = 15 (5.75%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 6 3 1 23 3 3 8 1 4 4 8 0 7 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 4 10 12 0 3 6 11 1 3 3 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 2 4 2 0 0 3 5 6 3 0 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 6 2 3 2 3 0 1 1 3 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 70 56 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 90 111 50
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 23 (6.07%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 23 (6.07%)
Leucine (Leu, L)
n = 55 (14.51%)
Isoleucine (Ile, I)
n = 37 (9.76%)
Methionine (Met, M)
n = 10 (2.64%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 36 (9.5%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 8 (2.11%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 19 8 7 8 28 5 7 4 3 5 4 14 0 16 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 4 11 10 1 4 11 7 5 1 11 6 3 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 8 0 1 7 11 0 2 3 7 6 0 0 4 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 3 6 7 1 0 2 6 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 96 101 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 89 74 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 147 136 77
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.86%)
Alanine (Ala, A)
n = 34 (10.49%)
Serine (Ser, S)
n = 20 (6.17%)
Threonine (Thr, T)
n = 21 (6.48%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.63%)
Leucine (Leu, L)
n = 63 (19.44%)
Isoleucine (Ile, I)
n = 29 (8.95%)
Methionine (Met, M)
n = 10 (3.09%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 10 (3.09%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 13 8 12 11 28 3 9 6 0 2 3 10 0 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 19 10 0 2 4 11 2 3 4 17 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 7 0 1 5 9 1 1 3 5 7 0 0 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 1 2 2 6 1 0 2 6 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 97 82 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 95 56 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 110 145 60
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 37 (10.66%)
Serine (Ser, S)
n = 20 (5.76%)
Threonine (Thr, T)
n = 37 (10.66%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 71 (20.46%)
Isoleucine (Ile, I)
n = 24 (6.92%)
Methionine (Met, M)
n = 28 (8.07%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 11 (3.17%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 13 21 11 15 31 4 10 11 1 0 0 6 1 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 8 19 9 1 2 7 6 2 2 8 11 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 2 3 4 10 0 0 3 4 7 0 0 4 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 1 2 9 1 0 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 107 111 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 113 58 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 106 159 63
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 37 (10.66%)
Serine (Ser, S)
n = 20 (5.76%)
Threonine (Thr, T)
n = 37 (10.66%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 71 (20.46%)
Isoleucine (Ile, I)
n = 24 (6.92%)
Methionine (Met, M)
n = 28 (8.07%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 11 (3.17%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 13 21 11 15 31 4 10 11 1 0 0 6 1 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 8 19 9 1 2 7 6 2 2 8 11 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 2 3 4 10 0 0 3 4 7 0 0 4 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 1 2 9 1 0 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 107 111 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 113 58 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 106 159 63
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (5.45%)
Alanine (Ala, A)
n = 38 (8.28%)
Serine (Ser, S)
n = 31 (6.75%)
Threonine (Thr, T)
n = 43 (9.37%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 18 (3.92%)
Leucine (Leu, L)
n = 88 (19.17%)
Isoleucine (Ile, I)
n = 42 (9.15%)
Methionine (Met, M)
n = 27 (5.88%)
Proline (Pro, P)
n = 26 (5.66%)
Phenylalanine (Phe, F)
n = 14 (3.05%)
Tyrosine (Tyr, Y)
n = 11 (2.4%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 13 (2.83%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 20 20 15 18 36 6 13 11 1 6 4 6 2 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 3 7 13 18 0 1 7 9 8 4 11 11 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 10 3 4 10 10 0 0 7 4 7 5 0 7 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 3 1 3 8 2 0 3 7 1 0 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 137 141 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 131 74 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 148 182 92
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 15 (15.31%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 4 4 3 11 1 3 2 1 0 1 1 0 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 2 8 5 0 0 4 0 0 0 0 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 2 2 2 0 0 4 0 0 1 1 0 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 0 0 0 1 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 32 20 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 31 14 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 40 38 16
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 46 (7.5%)
Serine (Ser, S)
n = 43 (7.01%)
Threonine (Thr, T)
n = 59 (9.62%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 24 (3.92%)
Leucine (Leu, L)
n = 91 (14.85%)
Isoleucine (Ile, I)
n = 55 (8.97%)
Methionine (Met, M)
n = 37 (6.04%)
Proline (Pro, P)
n = 30 (4.89%)
Phenylalanine (Phe, F)
n = 46 (7.5%)
Tyrosine (Tyr, Y)
n = 9 (1.47%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 11 (1.79%)
Asparagine (Asn, N)
n = 29 (4.73%)
Glutamine (Gln, Q)
n = 21 (3.43%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 22 (3.59%)
Arginine (Arg, R)
n = 10 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 32 30 12 16 37 11 11 16 5 5 9 10 0 14 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 5 7 24 14 1 1 10 16 4 3 10 15 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 21 2 4 10 16 1 2 10 6 3 1 4 13 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 3 6 7 22 0 1 1 8 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
125 153 214 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 166 122 253
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 225 238 110
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 15 (8.67%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 26 (15.03%)
Leucine (Leu, L)
n = 30 (17.34%)
Isoleucine (Ile, I)
n = 7 (4.05%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 13 (7.51%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 0 0 3 1 2 2 8 0 0 13 1 7 5 12 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 8 1 4 2 4 1 6 14 3 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 8 0 2 0 2 1 8 1 4 14 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 5 0 0 0 2 0 0 2 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 17 20 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 33 21 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 7 35 82
Total protein-coding genes (size: 11428 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 240 (6.3%)
Alanine (Ala, A)
n = 332 (8.72%)
Serine (Ser, S)
n = 237 (6.23%)
Threonine (Thr, T)
n = 299 (7.85%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 219 (5.75%)
Leucine (Leu, L)
n = 626 (16.44%)
Isoleucine (Ile, I)
n = 294 (7.72%)
Methionine (Met, M)
n = 184 (4.83%)
Proline (Pro, P)
n = 214 (5.62%)
Phenylalanine (Phe, F)
n = 239 (6.28%)
Tyrosine (Tyr, Y)
n = 114 (2.99%)
Tryptophan (Trp, W)
n = 121 (3.18%)
Aspartic acid (Asp, D)
n = 82 (2.15%)
Glutamic acid (Glu, E)
n = 93 (2.44%)
Asparagine (Asn, N)
n = 115 (3.02%)
Glutamine (Gln, Q)
n = 101 (2.65%)
Histidine (His, H)
n = 109 (2.86%)
Lysine (Lys, K)
n = 77 (2.02%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
149 145 133 92 108 276 45 83 87 14 53 48 105 13 100 139
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
51 6 21 63 143 119 7 22 72 100 46 30 69 102 13 63
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
118 109 9 35 66 75 3 11 47 53 61 16 22 42 73 27
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
82 75 18 34 48 71 6 5 14 52 5 0 0 9 0 105
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
966 1021 1027 794
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
522 1024 700 1562
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
268 1254 1501 785

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.