Viewing data for Andrias davidianus


Scientific name Andrias davidianus
Common name Chinese giant salamander
Maximum lifespan 19.90 years (Andrias davidianus@AnAge)

Total mtDNA (size: 16503 bases) GC AT G C A T
Base content (bases) 5860 10643 3482 2378 5372 5271
Base content per 1 kb (bases) 355 645 211 144 326 319
Base content (%) 35.5% 64.5%
Total protein-coding genes (size: 11345 bases) GC AT G C A T
Base content (bases) 4009 7336 2479 1530 3869 3467
Base content per 1 kb (bases) 353 647 219 135 341 306
Base content (%) 35.3% 64.7%
D-loop (size: 771 bases) GC AT G C A T
Base content (bases) 268 503 158 110 258 245
Base content per 1 kb (bases) 348 652 205 143 335 318
Base content (%) 34.8% 65.2%
Total tRNA-coding genes (size: 1537 bases) GC AT G C A T
Base content (bases) 560 977 304 256 462 515
Base content per 1 kb (bases) 364 636 198 167 301 335
Base content (%) 36.4% 63.6%
Total rRNA-coding genes (size: 2496 bases) GC AT G C A T
Base content (bases) 890 1606 466 424 671 935
Base content per 1 kb (bases) 357 643 187 170 269 375
Base content (%) 35.7% 64.3%
12S rRNA gene (size: 917 bases) GC AT G C A T
Base content (bases) 351 566 189 162 233 333
Base content per 1 kb (bases) 383 617 206 177 254 363
Base content (%) 38.3% 61.7%
16S rRNA gene (size: 1579 bases) GC AT G C A T
Base content (bases) 539 1040 277 262 438 602
Base content per 1 kb (bases) 341 659 175 166 277 381
Base content (%) 34.1% 65.9%

ATP6 (size: 682 bases) GC AT G C A T
Base content (bases) 231 451 155 76 249 202
Base content per 1 kb (bases) 339 661 227 111 365 296
Base content (%) 33.9% 66.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 46 122 32 14 56 66
Base content per 1 kb (bases) 274 726 190 83 333 393
Base content (%) 27.4% 72.6%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 581 970 318 263 547 423
Base content per 1 kb (bases) 375 625 205 170 353 273
Base content (%) 37.5% 62.5%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 239 449 146 93 229 220
Base content per 1 kb (bases) 347 653 212 135 333 320
Base content (%) 34.7% 65.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 302 482 173 129 272 210
Base content per 1 kb (bases) 385 615 221 165 347 268
Base content (%) 38.5% 61.5%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 457 684 285 172 365 319
Base content per 1 kb (bases) 401 599 250 151 320 280
Base content (%) 40.1% 59.9%
ND1 (size: 970 bases) GC AT G C A T
Base content (bases) 350 620 224 126 326 294
Base content per 1 kb (bases) 361 639 231 130 336 303
Base content (%) 36.1% 63.9%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 338 701 227 111 359 342
Base content per 1 kb (bases) 325 675 218 107 346 329
Base content (%) 32.5% 67.5%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 130 221 83 47 126 95
Base content per 1 kb (bases) 370 630 236 134 359 271
Base content (%) 37.0% 63.0%
ND4 (size: 1375 bases) GC AT G C A T
Base content (bases) 448 927 284 164 496 431
Base content per 1 kb (bases) 326 674 207 119 361 313
Base content (%) 32.6% 67.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 101 196 60 41 107 89
Base content per 1 kb (bases) 340 660 202 138 360 300
Base content (%) 34.0% 66.0%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 613 1199 368 245 643 556
Base content per 1 kb (bases) 338 662 203 135 355 307
Base content (%) 33.8% 66.2%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 183 336 130 53 103 233
Base content per 1 kb (bases) 353 647 250 102 198 449
Base content (%) 35.3% 64.7%

ATP6 (size: 682 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 11 (4.87%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.19%)
Leucine (Leu, L)
n = 52 (23.01%)
Isoleucine (Ile, I)
n = 22 (9.73%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 17 (7.52%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 7 10 9 3 9 4 26 7 1 4 2 8 0 8 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 2 4 0 6 1 1 1 9 3 4 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 2 4 3 3 0 2 3 3 0 1 1 9 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 0 1 4 0 1 2 1 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 58 74 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 59 34 111
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 38 94 81
ATP8 (size: 168 bases)
Amino acid sequence: MPQLSPGPWFAIFTISWMILLLILMPKINNLKSMNEPTFMGLFLNKPQSWNWPWI*
Amino acid frequencies:
Glycine (Gly, G)
n = 2 (3.64%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 2 (3.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 5 (9.09%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 4 0 0 1 0 6 2 0 0 0 0 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 1 1 0 0 1 6 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 1 1 1 0 1 0 0 0 0 1 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 10 22 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 13 12 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 9 32 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.72%)
Alanine (Ala, A)
n = 42 (8.14%)
Serine (Ser, S)
n = 37 (7.17%)
Threonine (Thr, T)
n = 38 (7.36%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.36%)
Leucine (Leu, L)
n = 60 (11.63%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 29 (5.62%)
Proline (Pro, P)
n = 27 (5.23%)
Phenylalanine (Phe, F)
n = 38 (7.36%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 16 (3.1%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 16 (3.1%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 6 21 11 4 10 2 29 5 2 14 4 15 5 27 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 13 15 13 1 12 14 16 3 12 1 13 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 20 2 7 7 16 1 3 3 16 3 3 4 14 2 14
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 3 10 6 8 0 4 2 3 0 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 90 137 140
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 96 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 90 190 202
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 14 (6.14%)
Serine (Ser, S)
n = 18 (7.89%)
Threonine (Thr, T)
n = 18 (7.89%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 9 (3.95%)
Leucine (Leu, L)
n = 25 (10.96%)
Isoleucine (Ile, I)
n = 25 (10.96%)
Methionine (Met, M)
n = 17 (7.46%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 9 (3.95%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 12 (5.26%)
Glutamic acid (Glu, E)
n = 12 (5.26%)
Asparagine (Asn, N)
n = 8 (3.51%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 8 (3.51%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 4 14 6 0 5 2 10 7 1 5 1 3 0 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 4 4 6 0 3 3 2 0 2 3 8 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 6 0 6 2 5 0 2 3 8 0 1 2 4 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 2 11 1 3 0 1 3 2 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 49 76 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 59 59 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 38 85 94
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 12 (4.62%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 25 (9.62%)
Isoleucine (Ile, I)
n = 19 (7.31%)
Methionine (Met, M)
n = 15 (5.77%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 28 (10.77%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 6 (2.31%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 6 14 6 1 7 0 10 7 1 9 2 4 2 22 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 7 7 6 0 2 9 4 5 5 2 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 0 5 3 1 0 0 3 8 4 1 1 0 2 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 3 3 3 2 0 1 0 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 52 62 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 61 54 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 60 94 93
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 20 (5.28%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 22 (5.8%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 32 (8.44%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 24 (6.33%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 12 14 13 12 11 8 15 5 2 9 3 7 3 16 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 5 7 8 0 5 5 10 8 4 5 13 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 13 1 3 4 15 0 1 2 13 2 4 0 8 8 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 1 4 5 10 0 0 2 6 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 96 102 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 92 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 97 141 111
ND1 (size: 970 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.97%)
Alanine (Ala, A)
n = 26 (8.07%)
Serine (Ser, S)
n = 24 (7.45%)
Threonine (Thr, T)
n = 21 (6.52%)
Cysteine (Cys, C)
n = 3 (0.93%)
Valine (Val, V)
n = 15 (4.66%)
Leucine (Leu, L)
n = 46 (14.29%)
Isoleucine (Ile, I)
n = 34 (10.56%)
Methionine (Met, M)
n = 20 (6.21%)
Proline (Pro, P)
n = 23 (7.14%)
Phenylalanine (Phe, F)
n = 23 (7.14%)
Tyrosine (Tyr, Y)
n = 13 (4.04%)
Tryptophan (Trp, W)
n = 9 (2.8%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 9 (2.8%)
Asparagine (Asn, N)
n = 11 (3.42%)
Glutamine (Gln, Q)
n = 5 (1.55%)
Histidine (His, H)
n = 4 (1.24%)
Lysine (Lys, K)
n = 9 (2.8%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 15 18 4 6 10 2 22 5 0 9 1 4 1 15 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 5 7 14 0 2 6 6 2 6 4 11 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 1 6 2 12 0 3 1 9 4 0 2 8 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 2 3 1 9 0 2 1 3 2 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 62 99 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 90 55 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 72 140 95
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.06%)
Alanine (Ala, A)
n = 25 (7.25%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 26 (7.54%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 68 (19.71%)
Isoleucine (Ile, I)
n = 33 (9.57%)
Methionine (Met, M)
n = 35 (10.14%)
Proline (Pro, P)
n = 13 (3.77%)
Phenylalanine (Phe, F)
n = 15 (4.35%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 16 (4.64%)
Glutamine (Gln, Q)
n = 12 (3.48%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 10 (2.9%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 10 31 9 7 14 0 33 10 2 2 1 5 2 11 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 3 13 9 0 5 5 1 3 3 1 8 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 9 6 11 0 4 2 2 4 3 5 10 6 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 1 1 0 10 0 1 0 3 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 69 126 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 90 59 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 68 157 100
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.06%)
Alanine (Ala, A)
n = 25 (7.25%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 26 (7.54%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 68 (19.71%)
Isoleucine (Ile, I)
n = 33 (9.57%)
Methionine (Met, M)
n = 35 (10.14%)
Proline (Pro, P)
n = 13 (3.77%)
Phenylalanine (Phe, F)
n = 15 (4.35%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 16 (4.64%)
Glutamine (Gln, Q)
n = 12 (3.48%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 10 (2.9%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 10 31 9 7 14 0 33 10 2 2 1 5 2 11 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 3 13 9 0 5 5 1 3 3 1 8 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 9 6 11 0 4 2 2 4 3 5 10 6 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 1 1 0 10 0 1 0 3 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 69 126 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 90 59 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 68 157 100
ND4 (size: 1375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.38%)
Alanine (Ala, A)
n = 30 (6.56%)
Serine (Ser, S)
n = 37 (8.1%)
Threonine (Thr, T)
n = 39 (8.53%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 14 (3.06%)
Leucine (Leu, L)
n = 88 (19.26%)
Isoleucine (Ile, I)
n = 45 (9.85%)
Methionine (Met, M)
n = 36 (7.88%)
Proline (Pro, P)
n = 21 (4.6%)
Phenylalanine (Phe, F)
n = 18 (3.94%)
Tyrosine (Tyr, Y)
n = 19 (4.16%)
Tryptophan (Trp, W)
n = 16 (3.5%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.19%)
Asparagine (Asn, N)
n = 19 (4.16%)
Glutamine (Gln, Q)
n = 12 (2.63%)
Histidine (His, H)
n = 9 (1.97%)
Lysine (Lys, K)
n = 9 (1.97%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
38 7 30 16 6 16 2 44 10 2 6 2 5 1 12 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 1 8 14 8 0 10 6 3 1 7 3 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 21 0 7 4 13 2 6 5 15 4 3 4 15 4 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 6 4 1 2 8 1 2 3 3 1 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 91 159 131
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
60 116 81 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 77 191 163
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 9 (9.18%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 3 (3.06%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 8 4 0 4 0 7 1 0 0 0 2 0 8 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 1 6 3 0 3 0 1 1 0 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 2 1 3 0 0 1 2 1 0 3 0 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 1 1 0 3 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 16 29 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 26 18 43
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 18 42 31
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.98%)
Alanine (Ala, A)
n = 45 (7.46%)
Serine (Ser, S)
n = 56 (9.29%)
Threonine (Thr, T)
n = 40 (6.63%)
Cysteine (Cys, C)
n = 9 (1.49%)
Valine (Val, V)
n = 21 (3.48%)
Leucine (Leu, L)
n = 94 (15.59%)
Isoleucine (Ile, I)
n = 63 (10.45%)
Methionine (Met, M)
n = 36 (5.97%)
Proline (Pro, P)
n = 24 (3.98%)
Phenylalanine (Phe, F)
n = 42 (6.97%)
Tyrosine (Tyr, Y)
n = 16 (2.65%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 13 (2.16%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 28 (4.64%)
Glutamine (Gln, Q)
n = 20 (3.32%)
Histidine (His, H)
n = 12 (1.99%)
Lysine (Lys, K)
n = 21 (3.48%)
Arginine (Arg, R)
n = 10 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
53 10 31 17 3 17 8 42 17 3 4 5 9 3 30 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 5 4 10 14 18 3 7 8 8 7 8 2 13 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 16 3 17 6 17 2 8 6 10 6 3 7 20 8 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 2 10 3 18 3 3 0 7 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
120 111 202 171
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 151 122 256
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 106 232 216
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.21%)
Alanine (Ala, A)
n = 14 (8.14%)
Serine (Ser, S)
n = 11 (6.4%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 5 (2.91%)
Valine (Val, V)
n = 17 (9.88%)
Leucine (Leu, L)
n = 25 (14.53%)
Isoleucine (Ile, I)
n = 12 (6.98%)
Methionine (Met, M)
n = 10 (5.81%)
Proline (Pro, P)
n = 6 (3.49%)
Phenylalanine (Phe, F)
n = 19 (11.05%)
Tyrosine (Tyr, Y)
n = 10 (5.81%)
Tryptophan (Trp, W)
n = 3 (1.74%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 5 (2.91%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 0 6 0 1 0 1 16 0 1 6 0 7 4 18 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 5 0 5 1 6 2 4 2 5 10 2 0 2 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 7 0 1 2 1 0 10 0 1 7 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 1 2 1 0 0 3 0 0 0 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 12 31 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 34 22 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 7 50 80
Total protein-coding genes (size: 11377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 223 (5.89%)
Alanine (Ala, A)
n = 266 (7.02%)
Serine (Ser, S)
n = 287 (7.57%)
Threonine (Thr, T)
n = 272 (7.18%)
Cysteine (Cys, C)
n = 34 (0.9%)
Valine (Val, V)
n = 183 (4.83%)
Leucine (Leu, L)
n = 597 (15.76%)
Isoleucine (Ile, I)
n = 342 (9.03%)
Methionine (Met, M)
n = 246 (6.49%)
Proline (Pro, P)
n = 196 (5.17%)
Phenylalanine (Phe, F)
n = 252 (6.65%)
Tyrosine (Tyr, Y)
n = 127 (3.35%)
Tryptophan (Trp, W)
n = 112 (2.96%)
Aspartic acid (Asp, D)
n = 72 (1.9%)
Glutamic acid (Glu, E)
n = 89 (2.35%)
Asparagine (Asn, N)
n = 138 (3.64%)
Glutamine (Gln, Q)
n = 94 (2.48%)
Histidine (His, H)
n = 99 (2.61%)
Lysine (Lys, K)
n = 84 (2.22%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
260 82 205 103 44 109 31 272 79 15 70 23 69 21 184 68
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
41 21 13 67 96 97 6 60 61 59 43 60 25 100 11 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
73 129 9 76 40 102 7 31 31 99 28 20 38 95 43 62
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
37 65 24 49 23 80 4 18 15 34 4 0 1 5 0 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
833 747 1145 1065
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
503 959 708 1620
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
275 702 1497 1316

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.