Viewing data for Ammotragus lervia


Scientific name Ammotragus lervia
Common name Aoudad
Maximum lifespan 21.70 years (Ammotragus lervia@AnAge)

Total mtDNA (size: 16530 bases) GC AT G C A T
Base content (bases) 6602 9927 4436 2166 4371 5556
Base content per 1 kb (bases) 399 601 268 131 264 336
Base content (%) 39.9% 60.1%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4552 6786 3228 1324 3073 3713
Base content per 1 kb (bases) 401 599 285 117 271 327
Base content (%) 40.1% 59.9%
D-loop (size: 1098 bases) GC AT G C A T
Base content (bases) 466 631 302 164 293 338
Base content per 1 kb (bases) 424 575 275 149 267 308
Base content (%) 42.4% 57.5%
Total tRNA-coding genes (size: 1512 bases) GC AT G C A T
Base content (bases) 553 959 323 230 423 536
Base content per 1 kb (bases) 366 634 214 152 280 354
Base content (%) 36.6% 63.4%
Total rRNA-coding genes (size: 2527 bases) GC AT G C A T
Base content (bases) 1007 1520 570 437 573 947
Base content per 1 kb (bases) 398 602 226 173 227 375
Base content (%) 39.8% 60.2%
12S rRNA gene (size: 958 bases) GC AT G C A T
Base content (bases) 406 552 235 171 201 351
Base content per 1 kb (bases) 424 576 245 178 210 366
Base content (%) 42.4% 57.6%
16S rRNA gene (size: 1569 bases) GC AT G C A T
Base content (bases) 601 968 335 266 372 596
Base content per 1 kb (bases) 383 617 214 170 237 380
Base content (%) 38.3% 61.7%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 267 414 193 74 195 219
Base content per 1 kb (bases) 392 608 283 109 286 322
Base content (%) 39.2% 60.8%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 63 138 52 11 54 84
Base content per 1 kb (bases) 313 687 259 55 269 418
Base content (%) 31.3% 68.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 657 888 399 258 452 436
Base content per 1 kb (bases) 425 575 258 167 293 282
Base content (%) 42.5% 57.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 272 412 179 93 172 240
Base content per 1 kb (bases) 398 602 262 136 251 351
Base content (%) 39.8% 60.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 340 444 228 112 230 214
Base content per 1 kb (bases) 434 566 291 143 293 273
Base content (%) 43.4% 56.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 484 656 335 149 290 366
Base content per 1 kb (bases) 425 575 294 131 254 321
Base content (%) 42.5% 57.5%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 386 570 278 108 264 306
Base content per 1 kb (bases) 404 596 291 113 276 320
Base content (%) 40.4% 59.6%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 379 663 296 83 277 386
Base content per 1 kb (bases) 364 636 284 80 266 370
Base content (%) 36.4% 63.6%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 153 193 117 36 82 111
Base content per 1 kb (bases) 442 558 338 104 237 321
Base content (%) 44.2% 55.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 552 826 402 150 389 437
Base content per 1 kb (bases) 401 599 292 109 282 317
Base content (%) 40.1% 59.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 114 183 79 35 89 94
Base content per 1 kb (bases) 384 616 266 118 300 316
Base content (%) 38.4% 61.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 717 1104 533 184 487 617
Base content per 1 kb (bases) 394 606 293 101 267 339
Base content (%) 39.4% 60.6%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 187 341 151 36 114 227
Base content per 1 kb (bases) 354 646 286 68 216 430
Base content (%) 35.4% 64.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 12 (5.31%)
Threonine (Thr, T)
n = 27 (11.95%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 46 (20.35%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 10 (4.42%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 13 (5.75%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 8 8 8 6 15 3 14 8 1 3 0 8 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 7 6 0 0 4 6 1 3 4 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 2 2 2 5 0 1 2 0 2 1 0 2 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 3 1 0 2 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 63 81 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 64 39 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 66 99 51
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLTLFIILQLKISKHNFYYNPELMATKTPKQNTPWETKWTKTYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 10 (15.15%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 12 (18.18%)
Isoleucine (Ile, I)
n = 4 (6.06%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 3 (4.55%)
Tyrosine (Tyr, Y)
n = 3 (4.55%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 3 2 2 4 0 4 2 1 0 0 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 1 3 1 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 6 1 0 0 4 0 0 0 2 1 0 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 18 27 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 21 20 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 13 37 13
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.59%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 36 (7.0%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 16 22 6 11 28 2 12 6 0 9 8 18 4 18 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 1 0 7 15 17 1 2 14 25 6 12 7 8 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 4 11 13 0 1 2 10 9 1 0 9 10 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 2 4 12 9 0 0 2 3 3 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 106 138 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 96 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 159 202 123
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 12 14 3 1 19 5 4 5 1 5 3 5 0 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 0 2 6 0 2 2 4 0 1 3 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 0 2 5 8 1 0 4 5 5 0 1 3 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 13 2 3 7 6 0 0 2 4 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 60 68 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 56 60 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 63 112 39
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 7 5 9 12 1 4 7 0 2 6 7 0 11 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 3 8 5 0 8 4 8 0 1 5 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 0 3 5 7 0 1 4 4 7 0 1 4 2 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 0 3 1 2 0 1 2 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 68 61 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 66 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 94 98 64
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 20 (5.28%)
Leucine (Leu, L)
n = 54 (14.25%)
Isoleucine (Ile, I)
n = 40 (10.55%)
Methionine (Met, M)
n = 20 (5.28%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 28 18 4 15 31 2 2 5 1 1 7 11 1 6 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 2 6 15 0 1 7 13 3 4 5 12 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 0 4 4 10 1 1 2 9 6 1 0 5 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 0 1 11 9 0 0 0 8 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 99 119 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 92 77 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 144 170 54
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 21 (6.62%)
Threonine (Thr, T)
n = 22 (6.94%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 16 (5.05%)
Leucine (Leu, L)
n = 55 (17.35%)
Isoleucine (Ile, I)
n = 29 (9.15%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 8 (2.52%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 14 17 6 10 31 0 8 7 0 4 2 9 1 5 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 11 13 0 0 5 6 1 3 11 7 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 14 0 1 5 13 0 1 1 5 7 0 0 4 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 1 2 6 2 1 0 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 87 91 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 91 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 100 158 54
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 44 (12.72%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 39 (11.27%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 15 37 4 14 28 1 9 9 0 3 1 2 1 6 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 7 8 0 1 5 8 0 0 7 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 19 2 1 8 13 2 0 2 2 5 0 0 4 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 84 154 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 105 56 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 107 176 55
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 44 (12.72%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 39 (11.27%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 15 37 4 14 28 1 9 9 0 3 1 2 1 6 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 7 8 0 1 5 8 0 0 7 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 19 2 1 8 13 2 0 2 2 5 0 0 4 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 84 154 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 105 56 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 107 176 55
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 42 (9.17%)
Threonine (Thr, T)
n = 33 (7.21%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 20 (4.37%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 25 27 17 14 40 3 19 11 0 3 6 6 0 9 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 3 2 13 12 2 1 8 9 0 1 11 8 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 20 2 3 16 11 0 3 9 5 10 0 2 9 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 0 1 3 11 0 2 3 4 1 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 128 155 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 113 83 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 161 199 79
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 10 1 3 11 1 5 2 0 0 1 5 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 2 1 5 0 1 1 2 0 0 1 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 1 6 2 0 0 1 0 4 0 1 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 22 29 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 34 48 12
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.79%)
Alanine (Ala, A)
n = 37 (6.11%)
Serine (Ser, S)
n = 46 (7.59%)
Threonine (Thr, T)
n = 64 (10.56%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 16 (2.64%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 61 (10.07%)
Methionine (Met, M)
n = 39 (6.44%)
Proline (Pro, P)
n = 25 (4.13%)
Phenylalanine (Phe, F)
n = 47 (7.76%)
Tyrosine (Tyr, Y)
n = 17 (2.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 34 (5.61%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 32 37 9 19 47 2 10 17 1 4 6 6 0 19 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 2 2 15 20 0 3 9 17 0 2 12 11 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 31 2 4 14 17 0 3 8 6 11 2 2 8 26 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 3 2 8 21 2 0 5 3 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 143 232 129
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 161 129 252
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 229 256 106
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 16 (9.14%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 13 (7.43%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 15 (8.57%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (2.86%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 1 4 0 0 0 0 13 0 1 13 1 4 7 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 0 5 0 1 0 11 1 4 10 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 2 4 1 1 1 4 0 8 2 1 3 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 8 3 1 1 4 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 5 48 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 24 33 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 7 33 90
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.69%)
Alanine (Ala, A)
n = 240 (6.32%)
Serine (Ser, S)
n = 271 (7.14%)
Threonine (Thr, T)
n = 334 (8.79%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 186 (4.9%)
Leucine (Leu, L)
n = 595 (15.67%)
Isoleucine (Ile, I)
n = 330 (8.69%)
Methionine (Met, M)
n = 258 (6.79%)
Proline (Pro, P)
n = 190 (5.0%)
Phenylalanine (Phe, F)
n = 244 (6.42%)
Tyrosine (Tyr, Y)
n = 128 (3.37%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 163 (4.29%)
Glutamine (Gln, Q)
n = 88 (2.32%)
Histidine (His, H)
n = 96 (2.53%)
Lysine (Lys, K)
n = 99 (2.61%)
Arginine (Arg, R)
n = 64 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
167 163 209 67 114 278 20 106 82 6 47 41 84 14 103 141
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
49 6 17 33 92 112 3 30 60 105 21 31 72 81 6 54
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
101 168 11 30 78 106 5 15 37 56 72 6 10 54 109 33
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 79 15 18 50 90 9 5 17 38 4 1 0 6 1 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
804 917 1237 841
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
460 983 743 1613
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
180 1227 1643 749

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.