Viewing data for Protopterus annectens


Scientific name Protopterus annectens
Common name African lungfish
Maximum lifespan 18.00 years (Protopterus annectens@AnAge)

Total mtDNA (size: 16657 bases) GC AT G C A T
Base content (bases) 6996 9661 4413 2583 4852 4809
Base content per 1 kb (bases) 420 580 265 155 291 289
Base content (%) 42.0% 58.0%
Total protein-coding genes (size: 11363 bases) GC AT G C A T
Base content (bases) 4766 6597 3180 1586 3447 3150
Base content per 1 kb (bases) 419 581 280 140 303 277
Base content (%) 41.9% 58.1%
D-loop (size: 1189 bases) GC AT G C A T
Base content (bases) 444 745 262 182 394 351
Base content per 1 kb (bases) 373 627 220 153 331 295
Base content (%) 37.3% 62.7%
Total tRNA-coding genes (size: 1537 bases) GC AT G C A T
Base content (bases) 683 854 381 302 388 466
Base content per 1 kb (bases) 444 556 248 196 252 303
Base content (%) 44.4% 55.6%
Total rRNA-coding genes (size: 2526 bases) GC AT G C A T
Base content (bases) 1077 1449 573 504 613 836
Base content per 1 kb (bases) 426 574 227 200 243 331
Base content (%) 42.6% 57.4%
12S rRNA gene (size: 934 bases) GC AT G C A T
Base content (bases) 428 506 232 196 208 298
Base content per 1 kb (bases) 458 542 248 210 223 319
Base content (%) 45.8% 54.2%
16S rRNA gene (size: 1592 bases) GC AT G C A T
Base content (bases) 649 943 341 308 405 538
Base content per 1 kb (bases) 408 592 214 193 254 338
Base content (%) 40.8% 59.2%

ATP6 (size: 682 bases) GC AT G C A T
Base content (bases) 279 403 195 84 215 188
Base content per 1 kb (bases) 409 591 286 123 315 276
Base content (%) 40.9% 59.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 62 106 49 13 51 55
Base content per 1 kb (bases) 369 631 292 77 304 327
Base content (%) 36.9% 63.1%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 690 858 409 281 475 383
Base content per 1 kb (bases) 446 554 264 182 307 247
Base content (%) 44.6% 55.4%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 286 405 176 110 190 215
Base content per 1 kb (bases) 414 586 255 159 275 311
Base content (%) 41.4% 58.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 349 435 217 132 236 199
Base content per 1 kb (bases) 445 555 277 168 301 254
Base content (%) 44.5% 55.5%
CYTB (size: 1144 bases) GC AT G C A T
Base content (bases) 488 656 337 151 355 301
Base content per 1 kb (bases) 427 573 295 132 310 263
Base content (%) 42.7% 57.3%
ND1 (size: 967 bases) GC AT G C A T
Base content (bases) 395 572 264 131 311 261
Base content per 1 kb (bases) 408 592 273 135 322 270
Base content (%) 40.8% 59.2%
ND2 (size: 1032 bases) GC AT G C A T
Base content (bases) 423 609 293 130 310 299
Base content per 1 kb (bases) 410 590 284 126 300 290
Base content (%) 41.0% 59.0%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 131 215 85 46 125 90
Base content per 1 kb (bases) 379 621 246 133 361 260
Base content (%) 37.9% 62.1%
ND4 (size: 1384 bases) GC AT G C A T
Base content (bases) 565 819 391 174 442 377
Base content per 1 kb (bases) 408 592 283 126 319 272
Base content (%) 40.8% 59.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 138 159 88 50 87 72
Base content per 1 kb (bases) 465 535 296 168 293 242
Base content (%) 46.5% 53.5%
ND5 (size: 1836 bases) GC AT G C A T
Base content (bases) 744 1092 517 227 564 528
Base content per 1 kb (bases) 405 595 282 124 307 288
Base content (%) 40.5% 59.5%
ND6 (size: 513 bases) GC AT G C A T
Base content (bases) 225 288 165 60 94 194
Base content per 1 kb (bases) 439 561 322 117 183 378
Base content (%) 43.9% 56.1%

ATP6 (size: 682 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 10 (4.42%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 54 (23.89%)
Isoleucine (Ile, I)
n = 21 (9.29%)
Methionine (Met, M)
n = 9 (3.98%)
Proline (Pro, P)
n = 15 (6.64%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 11 (4.87%)
Histidine (His, H)
n = 2 (0.88%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 5 7 11 9 17 3 11 10 1 5 1 3 1 8 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 7 5 6 1 1 3 3 2 0 8 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 1 3 0 2 1 1 3 3 2 1 3 4 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 1 0 1 0 1 3 2 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 74 68 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 64 33 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 57 87 66
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPDPWFIILLISWLTFLLILLPKILSHKTNNCPTPQSQDKLFLPPWNWPWL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 1 (1.82%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 12 (21.82%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 2 (3.64%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 0 1 2 3 1 5 3 0 0 0 0 0 3 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 0 0 0 0 0 0 0 0 1 3 4 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 1 1 0 0 0 1 0 0 1 0 0 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 1 1 3 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 20 17 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 14 14 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 15 24 13
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.32%)
Alanine (Ala, A)
n = 42 (8.16%)
Serine (Ser, S)
n = 29 (5.63%)
Threonine (Thr, T)
n = 37 (7.18%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (6.99%)
Leucine (Leu, L)
n = 66 (12.82%)
Isoleucine (Ile, I)
n = 40 (7.77%)
Methionine (Met, M)
n = 29 (5.63%)
Proline (Pro, P)
n = 28 (5.44%)
Phenylalanine (Phe, F)
n = 39 (7.57%)
Tyrosine (Tyr, Y)
n = 18 (3.5%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 11 (2.14%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.69%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 18 22 19 15 14 3 11 7 1 14 6 12 4 24 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 9 24 8 1 10 13 12 13 4 12 10 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 1 7 7 10 0 3 2 7 11 6 4 7 8 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 4 6 9 7 1 2 1 5 1 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 115 134 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 131 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 163 154 150
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.49%)
Alanine (Ala, A)
n = 17 (7.42%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 12 (5.24%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 18 (7.86%)
Leucine (Leu, L)
n = 25 (10.92%)
Isoleucine (Ile, I)
n = 21 (9.17%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 10 (4.37%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 13 (5.68%)
Asparagine (Asn, N)
n = 6 (2.62%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 9 (3.93%)
Lysine (Lys, K)
n = 5 (2.18%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 5 10 6 2 7 2 6 9 0 2 5 7 4 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 8 4 1 2 2 2 2 0 5 8 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 8 0 1 5 6 1 1 2 5 4 0 2 3 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 11 2 5 7 5 0 0 2 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 55 60 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 56 63 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 65 92 55
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 19 (7.31%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 2 5 8 5 11 2 7 8 0 9 5 5 0 15 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 3 15 5 0 2 10 5 3 0 4 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 13 1 1 5 2 1 2 2 8 4 3 0 1 2 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 2 2 3 2 0 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 67 53 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 68 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 82 90 75
CYTB (size: 1144 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 24 (6.32%)
Threonine (Thr, T)
n = 29 (7.63%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 14 (3.68%)
Leucine (Leu, L)
n = 62 (16.32%)
Isoleucine (Ile, I)
n = 33 (8.68%)
Methionine (Met, M)
n = 13 (3.42%)
Proline (Pro, P)
n = 20 (5.26%)
Phenylalanine (Phe, F)
n = 34 (8.95%)
Tyrosine (Tyr, Y)
n = 15 (3.95%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 7 (1.84%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 17 12 21 16 14 3 7 6 1 3 3 8 0 17 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 8 7 12 1 3 8 10 2 2 3 10 5 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 9 0 7 5 10 2 0 0 7 8 5 1 8 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 3 3 2 7 8 1 1 4 4 0 0 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 102 104 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 101 78 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 134 119 103
ND1 (size: 967 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.98%)
Alanine (Ala, A)
n = 28 (8.72%)
Serine (Ser, S)
n = 25 (7.79%)
Threonine (Thr, T)
n = 24 (7.48%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 17 (5.3%)
Leucine (Leu, L)
n = 57 (17.76%)
Isoleucine (Ile, I)
n = 28 (8.72%)
Methionine (Met, M)
n = 15 (4.67%)
Proline (Pro, P)
n = 23 (7.17%)
Phenylalanine (Phe, F)
n = 19 (5.92%)
Tyrosine (Tyr, Y)
n = 11 (3.43%)
Tryptophan (Trp, W)
n = 7 (2.18%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 11 (3.43%)
Asparagine (Asn, N)
n = 13 (4.05%)
Glutamine (Gln, Q)
n = 6 (1.87%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 8 (2.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 8 12 13 11 11 3 16 6 0 4 4 8 1 18 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 13 11 0 0 6 5 5 4 12 7 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 8 1 4 9 9 1 1 1 5 6 1 3 7 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 3 2 2 7 0 2 2 3 1 0 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 78 89 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 98 55 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 88 117 95
ND2 (size: 1032 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.96%)
Alanine (Ala, A)
n = 29 (8.45%)
Serine (Ser, S)
n = 28 (8.16%)
Threonine (Thr, T)
n = 38 (11.08%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 8 (2.33%)
Leucine (Leu, L)
n = 71 (20.7%)
Isoleucine (Ile, I)
n = 30 (8.75%)
Methionine (Met, M)
n = 18 (5.25%)
Proline (Pro, P)
n = 20 (5.83%)
Phenylalanine (Phe, F)
n = 12 (3.5%)
Tyrosine (Tyr, Y)
n = 9 (2.62%)
Tryptophan (Trp, W)
n = 11 (3.21%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.46%)
Asparagine (Asn, N)
n = 18 (5.25%)
Glutamine (Gln, Q)
n = 10 (2.92%)
Histidine (His, H)
n = 5 (1.46%)
Lysine (Lys, K)
n = 6 (1.75%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 8 11 20 12 14 6 16 8 2 1 3 3 1 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 1 5 14 9 1 3 5 6 3 1 4 14 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 20 2 3 14 6 0 0 5 4 5 2 3 14 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 1 5 1 1 1 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 91 115 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 110 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 92 128 94
ND3 (size: 1032 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.96%)
Alanine (Ala, A)
n = 29 (8.45%)
Serine (Ser, S)
n = 28 (8.16%)
Threonine (Thr, T)
n = 38 (11.08%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 8 (2.33%)
Leucine (Leu, L)
n = 71 (20.7%)
Isoleucine (Ile, I)
n = 30 (8.75%)
Methionine (Met, M)
n = 18 (5.25%)
Proline (Pro, P)
n = 20 (5.83%)
Phenylalanine (Phe, F)
n = 12 (3.5%)
Tyrosine (Tyr, Y)
n = 9 (2.62%)
Tryptophan (Trp, W)
n = 11 (3.21%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.46%)
Asparagine (Asn, N)
n = 18 (5.25%)
Glutamine (Gln, Q)
n = 10 (2.92%)
Histidine (His, H)
n = 5 (1.46%)
Lysine (Lys, K)
n = 6 (1.75%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 8 11 20 12 14 6 16 8 2 1 3 3 1 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 1 5 14 9 1 3 5 6 3 1 4 14 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 20 2 3 14 6 0 0 5 4 5 2 3 14 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 1 5 1 1 1 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 91 115 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 110 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 92 128 94
ND4 (size: 1384 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (5.22%)
Alanine (Ala, A)
n = 32 (6.96%)
Serine (Ser, S)
n = 35 (7.61%)
Threonine (Thr, T)
n = 37 (8.04%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 10 (2.17%)
Leucine (Leu, L)
n = 93 (20.22%)
Isoleucine (Ile, I)
n = 50 (10.87%)
Methionine (Met, M)
n = 30 (6.52%)
Proline (Pro, P)
n = 26 (5.65%)
Phenylalanine (Phe, F)
n = 19 (4.13%)
Tyrosine (Tyr, Y)
n = 15 (3.26%)
Tryptophan (Trp, W)
n = 16 (3.48%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 10 (2.17%)
Asparagine (Asn, N)
n = 14 (3.04%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 11 (2.39%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 10 (2.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 16 24 26 18 22 9 15 10 2 4 1 4 1 16 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 4 10 13 9 0 2 9 10 3 4 11 9 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 14 0 9 10 11 1 1 3 7 8 5 3 8 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 3 1 2 9 0 1 4 4 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 134 144 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 126 74 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 131 159 135
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (7.14%)
Alanine (Ala, A)
n = 14 (14.29%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 4 7 3 4 3 5 2 0 1 2 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 7 6 0 0 4 2 1 0 1 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 1 2 2 4 0 1 1 0 2 0 0 2 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 1 1 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
27 27 21 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 31 14 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 30 37 24
ND5 (size: 1836 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.58%)
Alanine (Ala, A)
n = 59 (9.66%)
Serine (Ser, S)
n = 47 (7.69%)
Threonine (Thr, T)
n = 53 (8.67%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 21 (3.44%)
Leucine (Leu, L)
n = 100 (16.37%)
Isoleucine (Ile, I)
n = 52 (8.51%)
Methionine (Met, M)
n = 27 (4.42%)
Proline (Pro, P)
n = 28 (4.58%)
Phenylalanine (Phe, F)
n = 50 (8.18%)
Tyrosine (Tyr, Y)
n = 14 (2.29%)
Tryptophan (Trp, W)
n = 12 (1.96%)
Aspartic acid (Asp, D)
n = 11 (1.8%)
Glutamic acid (Glu, E)
n = 11 (1.8%)
Asparagine (Asn, N)
n = 32 (5.24%)
Glutamine (Gln, Q)
n = 23 (3.76%)
Histidine (His, H)
n = 11 (1.8%)
Lysine (Lys, K)
n = 19 (3.11%)
Arginine (Arg, R)
n = 8 (1.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 20 22 24 22 29 8 14 23 0 8 4 9 0 37 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 2 6 31 22 0 4 8 12 4 7 9 11 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 19 2 5 15 19 1 4 3 6 8 6 3 16 16 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 8 3 5 6 16 3 2 1 5 0 1 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
130 153 191 138
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
61 180 121 250
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 184 216 176
ND6 (size: 513 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (18.24%)
Alanine (Ala, A)
n = 14 (8.24%)
Serine (Ser, S)
n = 13 (7.65%)
Threonine (Thr, T)
n = 3 (1.76%)
Cysteine (Cys, C)
n = 2 (1.18%)
Valine (Val, V)
n = 18 (10.59%)
Leucine (Leu, L)
n = 31 (18.24%)
Isoleucine (Ile, I)
n = 11 (6.47%)
Methionine (Met, M)
n = 4 (2.35%)
Proline (Pro, P)
n = 4 (2.35%)
Phenylalanine (Phe, F)
n = 13 (7.65%)
Tyrosine (Tyr, Y)
n = 6 (3.53%)
Tryptophan (Trp, W)
n = 7 (4.12%)
Aspartic acid (Asp, D)
n = 3 (1.76%)
Glutamic acid (Glu, E)
n = 5 (2.94%)
Asparagine (Asn, N)
n = 2 (1.18%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 2 3 6 0 2 1 17 0 0 5 1 5 7 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 4 0 8 2 4 1 7 19 1 1 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 1 4 0 1 3 4 1 2 4 3 5 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 2 2 1 0 0 2 0 1 0 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 16 25 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 29 17 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 15 52 58
Total protein-coding genes (size: 11392 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 237 (6.25%)
Alanine (Ala, A)
n = 313 (8.25%)
Serine (Ser, S)
n = 257 (6.77%)
Threonine (Thr, T)
n = 295 (7.78%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 177 (4.67%)
Leucine (Leu, L)
n = 656 (17.29%)
Isoleucine (Ile, I)
n = 320 (8.43%)
Methionine (Met, M)
n = 175 (4.61%)
Proline (Pro, P)
n = 211 (5.56%)
Phenylalanine (Phe, F)
n = 246 (6.48%)
Tyrosine (Tyr, Y)
n = 119 (3.14%)
Tryptophan (Trp, W)
n = 113 (2.98%)
Aspartic acid (Asp, D)
n = 72 (1.9%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 142 (3.74%)
Glutamine (Gln, Q)
n = 101 (2.66%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 72 (1.9%)
Arginine (Arg, R)
n = 70 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
215 105 134 170 118 157 46 137 94 7 57 37 64 19 176 70
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
41 11 16 62 142 102 7 31 72 77 57 26 74 97 14 64
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
97 124 10 48 74 82 11 18 24 56 63 35 28 73 69 33
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
60 68 25 31 41 66 6 13 19 35 3 1 0 2 3 78
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
892 966 1047 890
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
490 1034 697 1574
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
312 1081 1318 1084

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.